DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11099 and CG10307

DIOPT Version :9

Sequence 1:NP_001286627.1 Gene:CG11099 / 37282 FlyBaseID:FBgn0034485 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001286690.1 Gene:CG10307 / 37477 FlyBaseID:FBgn0034655 Length:341 Species:Drosophila melanogaster


Alignment Length:277 Identity:73/277 - (26%)
Similarity:118/277 - (42%) Gaps:50/277 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LHWSYLNFKDVPMDLFLYEDLEEVYLKENFISVIPKWLLNITTLKFIHLAGNNLSELPVDIYMLE 70
            |:.|:....|||..:...|.|.:::|.:|.::.||..:.::..|:.:.|..|.|.|.|:.|..|.
  Fly    28 LNLSHYQISDVPGIIEK
CETLMKLFLNQNKLTKIPSSIGSLMRLQVLTLDYNKLDEFPLCICRLV 92

  Fly    71 NLEFLDVSNNELKELPPTLGLLLNLQQLNVSGNQLTELPVELSGLRNLEHLNIGKNQFRRLPVQL 135
            .|:||::|.|.:..|||.||.|..|:....:...|.|||.|:....:||.|.:..|..::|    
  Fly    93 RLKFLNISCNNISSLPPELGYLTQLETFWCNNTGLLELPNEIRNCEHLETLGVRGNPLKKL---- 153

  Fly   136 SECVRLNELNVSDNEALVHIPERISNLPMLQSLAADRCALVYLPAALSKFMNHVRIFHNTAINYI 200
                                |:.|..|..|:.|.|:.|.|..:|..::...|.|.:         
  Fly   154 --------------------PDAIGALSSLRWLTAEGCELSEVPLTMALLGNLVHL--------- 189

  Fly   201 PMVYERFYQNFYDNRQRNTP---VAVHRKGLFWVREL---ETSTRLLLPVGTRTVFPVPSVENRV 259
                     |...||.|..|   :|:.:....::.|.   |..||..|. ..||:..:...:|.:
  Fly   190 ---------NLKGNRLRRLPRMLMAMQKLRFAFLNENCIDEMPTRSQLE-ELRTLHMLNLSKNPI 244

  Fly   260 SLYDDC-LHALQTLNRF 275
            ||:.|. |.||:..|.:
  Fly   245 SLHRDLQLMALRQTNLY 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11099NP_001286627.1 leucine-rich repeat 4..25 CDD:275380 5/18 (28%)
LRR_8 26..82 CDD:290566 18/55 (33%)
leucine-rich repeat 26..48 CDD:275380 5/21 (24%)
LRR <43..>194 CDD:227223 41/150 (27%)
LRR_4 47..87 CDD:289563 14/39 (36%)
leucine-rich repeat 49..71 CDD:275380 8/21 (38%)
leucine-rich repeat 72..95 CDD:275380 11/22 (50%)
leucine-rich repeat 96..117 CDD:275380 5/20 (25%)
leucine-rich repeat 118..140 CDD:275380 5/21 (24%)
leucine-rich repeat 141..164 CDD:275380 3/22 (14%)
CG10307NP_001286690.1 leucine-rich repeat 27..44 CDD:275380 5/15 (33%)
LRR_8 47..104 CDD:290566 18/56 (32%)
leucine-rich repeat 48..70 CDD:275380 5/21 (24%)
LRR 69..>244 CDD:227223 55/217 (25%)
leucine-rich repeat 71..93 CDD:275380 8/21 (38%)
leucine-rich repeat 94..116 CDD:275380 11/21 (52%)
leucine-rich repeat 117..139 CDD:275380 6/21 (29%)
leucine-rich repeat 140..162 CDD:275380 8/45 (18%)
leucine-rich repeat 163..185 CDD:275380 6/21 (29%)
leucine-rich repeat 186..208 CDD:275380 7/39 (18%)
leucine-rich repeat 209..233 CDD:275380 5/24 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467250
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.