DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11099 and CG32687

DIOPT Version :9

Sequence 1:NP_001286627.1 Gene:CG11099 / 37282 FlyBaseID:FBgn0034485 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001259412.1 Gene:CG32687 / 31980 FlyBaseID:FBgn0052687 Length:377 Species:Drosophila melanogaster


Alignment Length:198 Identity:54/198 - (27%)
Similarity:95/198 - (47%) Gaps:18/198 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LEEVYLKENFISVIPKWLLNITTLKFIHLAGNNLSELPVDIYMLENLEFLDVSNNELKELPPTLG 90
            |:|:.|..|.::..|:.:..:..||:::|.||.:|.:..||:.:::|..|.:..|.:.|:|..:|
  Fly   134 LKELNLSGNQLTHFPEQVTELRHLKYLYLGGNKISSVSKDIWKMQSLHVLSLGGNLISEVPEAVG 198

  Fly    91 LLLNLQQLNVSGNQLTELPVELSGLRNLEHLNIGKNQFRRLPVQLSECVRLNELNVSDNEALVH- 154
            .|..||.|.:..|.:..||..::.|:||:.|.:.||:.|.||..:.....|.||::.||..:|. 
  Fly   199 SLNQLQALVLCDNLIEILPTSIARLKNLKSLLLHKNRLRHLPKDIVALKNLTELSLRDNPLVVRF 263

  Fly   155 IPERISNLPMLQSLA-------ADRCALVYLPAALSKFMNHVRIFHNTAINYIPMVYERFYQNFY 212
            :.:.....|.|..||       ..|.....:|..|::::|......|.....:          |:
  Fly   264 VQDMALKPPTLLELAGRMVKASGQRPGPYDIPRTLAEYLNSANCCVNPNCKGV----------FF 318

  Fly   213 DNR 215
            |||
  Fly   319 DNR 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11099NP_001286627.1 leucine-rich repeat 4..25 CDD:275380
LRR_8 26..82 CDD:290566 16/55 (29%)
leucine-rich repeat 26..48 CDD:275380 5/21 (24%)
LRR <43..>194 CDD:227223 44/158 (28%)
LRR_4 47..87 CDD:289563 12/39 (31%)
leucine-rich repeat 49..71 CDD:275380 8/21 (38%)
leucine-rich repeat 72..95 CDD:275380 7/22 (32%)
leucine-rich repeat 96..117 CDD:275380 6/20 (30%)
leucine-rich repeat 118..140 CDD:275380 7/21 (33%)
leucine-rich repeat 141..164 CDD:275380 6/23 (26%)
CG32687NP_001259412.1 leucine-rich repeat 72..92 CDD:275380
leucine-rich repeat 94..133 CDD:275380
LRR_8 132..190 CDD:290566 16/55 (29%)
LRR_4 134..171 CDD:289563 11/36 (31%)
leucine-rich repeat 134..156 CDD:275380 5/21 (24%)
leucine-rich repeat 157..179 CDD:275380 8/21 (38%)
leucine-rich repeat 180..202 CDD:275380 7/21 (33%)
LRR_8 202..259 CDD:290566 20/56 (36%)
leucine-rich repeat 203..225 CDD:275380 7/21 (33%)
leucine-rich repeat 226..248 CDD:275380 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467249
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.