DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11099 and Lrrc57

DIOPT Version :9

Sequence 1:NP_001286627.1 Gene:CG11099 / 37282 FlyBaseID:FBgn0034485 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_006234842.1 Gene:Lrrc57 / 311346 RGDID:1307128 Length:281 Species:Rattus norvegicus


Alignment Length:164 Identity:60/164 - (36%)
Similarity:95/164 - (57%) Gaps:5/164 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LYEDLEEVYLKENFISVIPKWLL-NITTLKFIHLAGNNLSELPVDIYMLENLEFLDVSNNELKEL 85
            |..:|..:.|..|.|..:|..:: ..|.||.:.|..|.|:.||.::..|:.||.|.::||.|:||
  Rat    78 LTSNLRTIDLSNNKIDSLPPLIIGKFTLLKSLSLNNNKLTVLPDELCNLKKLETLSLNNNHLREL 142

  Fly    86 PPTLGLLLNLQQLNVSGNQLTELPVELSGLRNLEHLNIGKNQFRRLPVQLSECVRLNELNVSDNE 150
            |.:.|.|..|:.|::|||||..||.:|..||:|:.:::.|||.|.:|..:.| ::..|||::.|:
  Rat   143 PSSFGQLSALKTLSLSGNQLGALPPQLCSLRHLDVVDLSKNQIRSIPDTVGE-LQAIELNLNQNQ 206

  Fly   151 ALVHIPERISNLPMLQSL-AADRC-ALVYLPAAL 182
             :..|..|||..|.|:.| ..:.| .|..||.::
  Rat   207 -ISQISVRISCCPRLKVLRLEENCLELSMLPQSI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11099NP_001286627.1 leucine-rich repeat 4..25 CDD:275380 1/2 (50%)
LRR_8 26..82 CDD:290566 19/56 (34%)
leucine-rich repeat 26..48 CDD:275380 5/22 (23%)
LRR <43..>194 CDD:227223 54/143 (38%)
LRR_4 47..87 CDD:289563 17/39 (44%)
leucine-rich repeat 49..71 CDD:275380 8/21 (38%)
leucine-rich repeat 72..95 CDD:275380 11/22 (50%)
leucine-rich repeat 96..117 CDD:275380 10/20 (50%)
leucine-rich repeat 118..140 CDD:275380 7/21 (33%)
leucine-rich repeat 141..164 CDD:275380 8/22 (36%)
Lrrc57XP_006234842.1 LRR_RI <65..233 CDD:238064 57/156 (37%)
LRR_8 80..139 CDD:290566 19/58 (33%)
leucine-rich repeat 82..105 CDD:275380 5/22 (23%)
leucine-rich repeat 106..128 CDD:275380 8/21 (38%)
LRR_8 127..185 CDD:290566 26/57 (46%)
leucine-rich repeat 129..151 CDD:275380 11/21 (52%)
leucine-rich repeat 152..174 CDD:275380 11/21 (52%)
leucine-rich repeat 175..197 CDD:275380 7/22 (32%)
leucine-rich repeat 198..219 CDD:275380 8/21 (38%)
leucine-rich repeat 220..241 CDD:275380 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.