DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11099 and Lrrc2

DIOPT Version :9

Sequence 1:NP_001286627.1 Gene:CG11099 / 37282 FlyBaseID:FBgn0034485 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_006243988.1 Gene:Lrrc2 / 301033 RGDID:1311716 Length:379 Species:Rattus norvegicus


Alignment Length:182 Identity:63/182 - (34%)
Similarity:101/182 - (55%) Gaps:2/182 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NKTILHWSYLNFKDVPMDLFLYEDLEEVYLKENFISVIPKWLLNITTLKFIHLAGNNLSELPVDI 66
            |..:...|...:|::|..|.....|:|.::....|.:||.::....::|.:.|..|.::.||.:|
  Rat   107 NPFVFELSGTQWKELPDSLKEQTHLKEWHIHNTLIQIIPTYIELFHSMKILDLPKNQITCLPPEI 171

  Fly    67 YMLENLEFLDVSNNELKELPPTLGLLLNLQQLNVSGN-QLTELPVELSGLRNLEHLNIGKNQFRR 130
            ..|:||:.|:||.|.||.:||.||...||::|:.||| .|.|||.|||.|:.:..::|..|:|..
  Rat   172 GRLKNLKELNVSFNHLKSIPPELGDCENLERLDCSGNLDLMELPFELSNLKQVTFVDISANKFSS 236

  Fly   131 LPVQLSECVRLNELNVSDNEALVHIPERISNLPMLQSLAADRCALVYLPAAL 182
            :|:.:....||..|::|.|: |..:|:.|..|..||.....:..|.|||.|:
  Rat   237 VPICVLRMCRLQWLDISSND-LTDLPQDIDRLEELQGFLLYKNKLTYLPQAM 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11099NP_001286627.1 leucine-rich repeat 4..25 CDD:275380 4/20 (20%)
LRR_8 26..82 CDD:290566 18/55 (33%)
leucine-rich repeat 26..48 CDD:275380 5/21 (24%)
LRR <43..>194 CDD:227223 53/141 (38%)
LRR_4 47..87 CDD:289563 15/39 (38%)
leucine-rich repeat 49..71 CDD:275380 7/21 (33%)
leucine-rich repeat 72..95 CDD:275380 11/22 (50%)
leucine-rich repeat 96..117 CDD:275380 12/21 (57%)
leucine-rich repeat 118..140 CDD:275380 4/21 (19%)
leucine-rich repeat 141..164 CDD:275380 8/22 (36%)
Lrrc2XP_006243988.1 leucine-rich repeat 131..153 CDD:275380 5/21 (24%)
LRR_8 153..209 CDD:290566 24/55 (44%)
leucine-rich repeat 154..176 CDD:275380 7/21 (33%)
LRR_4 175..>209 CDD:289563 17/33 (52%)
leucine-rich repeat 177..199 CDD:275380 11/21 (52%)
leucine-rich repeat 200..223 CDD:275380 13/22 (59%)
leucine-rich repeat 224..245 CDD:275380 4/20 (20%)
LRR_8 246..303 CDD:290566 16/43 (37%)
leucine-rich repeat 247..269 CDD:275380 8/22 (36%)
leucine-rich repeat 270..292 CDD:275380 7/18 (39%)
leucine-rich repeat 293..316 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.