DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11099 and LRRC28

DIOPT Version :9

Sequence 1:NP_001286627.1 Gene:CG11099 / 37282 FlyBaseID:FBgn0034485 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001308604.1 Gene:LRRC28 / 123355 HGNCID:28355 Length:367 Species:Homo sapiens


Alignment Length:368 Identity:97/368 - (26%)
Similarity:159/368 - (43%) Gaps:58/368 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LHWSYLNFKDVPMDLFLYED---LEEVYLKENFISVIPKWLL-NITTLKFIHLAGNNLSELPVDI 66
            |..:|.|....|::|...|.   ||.:|:|.|.::.:|:.|. .:..|..::|..||:..:|..|
Human    20 LFLNYRNLHHFPLELLK
DEGLQYLERLYMKRNSLTSLPENLAQKLPNLVELYLHSNNIVVVPEAI 84

  Fly    67 YMLENLEFLDVSNNELKELPPTLGLLLNLQQLNVSGNQLTELPVELSGLRNLEHLNIGKNQFRRL 131
            ..|..|:.||:|:|.|:.:.|.:|.|..|:.|.::.|||..||.|:..|:.|:.|:|..|:...|
Human    85 GSLVKLQCLDLSDNALEIVCPEIGRLRALRHLRLANNQLQFLPPEVGDLKELQTLDISTNRLLTL 149

  Fly   132 PVQLSECVRLNELNVSDNEALVHIPERISNLPMLQ--SLAADRCALVYLPAALSKFMNHVRIFHN 194
            |.:|..|:.|..|.| |...|.::|..:..||.|.  |:|.:|.|.:.|....|:.:.:|.:.:|
Human   150 PERLHMCLSLQYLTV-DRNRLWYVPRHLCQLPSLNELSMAGNRLAFLPLDLGRSRELQYVYVDNN 213

  Fly   195 TAINYIPMVYERFYQNFYDNRQRNTPVAVHRKGLFWVRELETSTRLLLPVGTRTVF--------- 250
            ..:..:|   ...|...........|:.|..     |:.|..|:      |.||||         
Human   214 IHLKGLP---SYLYNKVIGCSGCGAPIQVSE-----VKLLSFSS------GQRTVFLPAEVKAIG 264

  Fly   251 -------PVPSVENRVSLYDDCLHALQTLNRFTPVYENVAMHRLLPEPYISSHINNGPIARCTNS 308
                   |:..:..| .||......|:.||..:|    :::.|.|.|      :.:.|:..|  .
Human   265 TEHDHVLPLQELAMR-GLYHTYHSLLKDLNFLSP----ISLPRSLLE------LLHCPLGHC--H 316

  Fly   309 TCSRCLYTSYYFMVVKRRGSTSKQL--------FTCNFCTNRC 343
            .||..::|..|..:...|.:....|        |....|:.:|
Human   317 RCSEPMFTIVYPKLFPLRETPMAGLHQWKTTVSFVAYCCSTQC 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11099NP_001286627.1 leucine-rich repeat 4..25 CDD:275380 5/18 (28%)
LRR_8 26..82 CDD:290566 19/56 (34%)
leucine-rich repeat 26..48 CDD:275380 7/22 (32%)
LRR <43..>194 CDD:227223 50/153 (33%)
LRR_4 47..87 CDD:289563 13/39 (33%)
leucine-rich repeat 49..71 CDD:275380 7/21 (33%)
leucine-rich repeat 72..95 CDD:275380 9/22 (41%)
leucine-rich repeat 96..117 CDD:275380 8/20 (40%)
leucine-rich repeat 118..140 CDD:275380 8/21 (38%)
leucine-rich repeat 141..164 CDD:275380 7/22 (32%)
LRRC28NP_001308604.1 LRR 1 16..36 5/15 (33%)
LRR 2 42..63 7/20 (35%)
leucine-rich repeat 43..66 CDD:275380 7/22 (32%)
NEL <46..>306 CDD:330839 77/279 (28%)
LRR 3 66..87 6/20 (30%)
leucine-rich repeat 67..89 CDD:275380 7/21 (33%)
LRR 4 89..110 8/20 (40%)
leucine-rich repeat 90..135 CDD:275380 18/44 (41%)
LRR 5 112..133 8/20 (40%)
LRR 6 135..156 7/20 (35%)
leucine-rich repeat 136..158 CDD:275380 8/21 (38%)
LRR 7 158..180 6/22 (27%)
leucine-rich repeat 159..181 CDD:275380 7/22 (32%)
LRR 8 181..202 6/20 (30%)
leucine-rich repeat 182..204 CDD:275380 7/21 (33%)
LRR 9 204..226 4/24 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D333471at33208
OrthoFinder 1 1.000 - - FOG0004967
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.