DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11099 and lrrc2

DIOPT Version :9

Sequence 1:NP_001286627.1 Gene:CG11099 / 37282 FlyBaseID:FBgn0034485 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_002940651.1 Gene:lrrc2 / 100486200 XenbaseID:XB-GENE-962135 Length:366 Species:Xenopus tropicalis


Alignment Length:178 Identity:55/178 - (30%)
Similarity:99/178 - (55%) Gaps:7/178 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 HWSYLNFKDVPMDLFLYEDLEEVYLKENFISVIPKWLLNITTLKFIHLAGNNLSELPVDIYMLEN 71
            ||     :::|..|.....|:::::....|..||.::.....|..:.|:.|.:..||.:|..|.|
 Frog   105 HW-----EELPDSLREQTHLKQLHVNNTRIQTIPDYIQLFQKLIVLDLSHNKIRCLPPEIGYLAN 164

  Fly    72 LEFLDVSNNELKELPPTLGLLLNLQQLNVSGN-QLTELPVELSGLRNLEHLNIGKNQFRRLPVQL 135
            |:..::|.|.|:.:||.||...||::|::||| :|||||.|||.|:.:..:::..|:|..:|:.:
 Frog   165 LKEFNISFNNLQIIPPELGNCENLEKLDLSGNLELTELPFELSSLKKVTFVDVSANKFSSIPICV 229

  Fly   136 SECVRLNELNVSDNEALVHIPERISNLPMLQSLAADRCALVYLPAALS 183
            .....|..|::|.|: |..:|:.|..|..|::|...:..:.||.|.::
 Frog   230 LRMSSLQWLDISSNK-LQDLPQDIDRLEELETLMLQKNKITYLSAEIT 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11099NP_001286627.1 leucine-rich repeat 4..25 CDD:275380 4/17 (24%)
LRR_8 26..82 CDD:290566 15/55 (27%)
leucine-rich repeat 26..48 CDD:275380 4/21 (19%)
LRR <43..>194 CDD:227223 47/142 (33%)
LRR_4 47..87 CDD:289563 12/39 (31%)
leucine-rich repeat 49..71 CDD:275380 7/21 (33%)
leucine-rich repeat 72..95 CDD:275380 8/22 (36%)
leucine-rich repeat 96..117 CDD:275380 13/21 (62%)
leucine-rich repeat 118..140 CDD:275380 3/21 (14%)
leucine-rich repeat 141..164 CDD:275380 8/22 (36%)
lrrc2XP_002940651.1 LRR 103..>314 CDD:227223 55/178 (31%)
leucine-rich repeat 119..141 CDD:275380 4/21 (19%)
leucine-rich repeat 142..164 CDD:275380 7/21 (33%)
leucine-rich repeat 165..187 CDD:275380 8/21 (38%)
leucine-rich repeat 188..211 CDD:275380 14/22 (64%)
leucine-rich repeat 212..234 CDD:275380 3/21 (14%)
leucine-rich repeat 235..257 CDD:275380 8/22 (36%)
leucine-rich repeat 258..280 CDD:275380 5/19 (26%)
leucine-rich repeat 281..303 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.