DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11044 and GRR1

DIOPT Version :9

Sequence 1:NP_611456.1 Gene:CG11044 / 37281 FlyBaseID:FBgn0034484 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_012623.1 Gene:GRR1 / 853552 SGDID:S000003850 Length:1151 Species:Saccharomyces cerevisiae


Alignment Length:529 Identity:104/529 - (19%)
Similarity:178/529 - (33%) Gaps:185/529 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 RYLPDLVLEQIFTYLTPKERYYAGLVCRQWYRAFYLPTVWN-------NFLVDDRTLTKPKFNYY 109
            |.:.|.|.:.:.||            |.: .:.||:|...|       ||:|....|.:.|....
Yeast   451 RDVSDDVFDTLATY------------CPR-VQGFYVPQARNVTFDSLRNFIVHSPMLKRIKITAN 502

  Fly   110 SGWQFCLDHMRTQFC-------------------LSRIGRYVRGIEFRPWHSFN---NIFQFMTM 152
            :.....|..:....|                   |..:.|.|:..|||..|:.|   |:||.::.
Yeast   503 NNMNDELVELLANKCPLLVEVDITLSPNVTDSSLLKLLTRLVQLREFRITHNTNITDNLFQELSK 567

  Fly   153 LTWNIDKGREVNPD----------TQFIGIGSRIRTLVYHFPCNMSQPNDPEGIKLFGTGGQLLR 207
            :..::...|.::..          ...:.:..::|.:   |....|:..|....:|...|..|..
Yeast   568 VVDDMPSLRLIDLSGCENITDKTIESIVNLAPKLRNV---FLGKCSRITDASLFQLSKLGKNLQT 629

  Fly   208 VLKELLLRLTD------LHT---LKLVDFVLERYEANHLLDEVVCSCCTKMRVLNLVNVTTMHC- 262
            |.......:||      .|:   ::.|||                :|||     ||.|.|.... 
Yeast   630 VHFGHCFNITDNGVRALFHSCTRIQYVDF----------------ACCT-----NLTNRTLYELA 673

  Fly   263 ---PIMHVGLFLNLQVLTISPQNIDDDVLSLLA-----DTKLRHLHLLQNCYTPSHLTI------ 313
               .:..:||....|:       .|:.:|::::     || |..:| |..|   |:|||      
Yeast   674 DLPKLKRIGLVKCTQM-------TDEGLLNMVSLRGRNDT-LERVH-LSYC---SNLTIYPIYEL 726

  Fly   314 -SACGVKAWRNVKKTNPRLRVHLRLENLTDGEVVLQPEAPVHSITYCAPQTRIRAELLVRMVDHY 377
             .:|            |||. ||   :||.....|:|:..:    ||.|.....:|       :.
Yeast   727 LMSC------------PRLS-HL---SLTAVPSFLRPDITM----YCRPAPSDFSE-------NQ 764

  Fly   378 KSTLAVYG----HEL---LPRFSSPK--PFHSRIDSLMLLMCRQ---CFNVDTL------IIREK 424
            :....|:.    |:|   |...:||.  | |..::.::....|.   .||.:||      ||.: 
Yeast   765 RQIFCVFSGKGVHKLRHYLVNLTSPAFGP-HVDVNDVLTKYIRSKNLIFNGETLEDALRRIITD- 827

  Fly   425 VSTSTLLLIAKTAKN----------LQHLHVRRFAVILRCDWPRHPEWSNEFYAWLKRNSRSYEA 479
            ::..:..:||.|..|          .|:::..|.               :|.::|..........
Yeast   828 LNQDSAAIIAATGLNQINGLNNDFLFQNINFERI---------------DEVFSWYLNTFDGIRM 877

  Fly   480 VEREISQIL 488
            ...|::.:|
Yeast   878 SSEEVNSLL 886

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11044NP_611456.1 F-box-like 51..94 CDD:289689 10/48 (21%)
GRR1NP_012623.1 F-box-like 320..361 CDD:403981
AMN1 404..559 CDD:187754 25/120 (21%)
leucine-rich repeat 416..441 CDD:275381
leucine-rich repeat 442..467 CDD:275381 6/27 (22%)
leucine-rich repeat 494..519 CDD:275381 4/24 (17%)
leucine-rich repeat 520..545 CDD:275381 2/24 (8%)
leucine-rich repeat 546..574 CDD:275381 8/27 (30%)
AMN1 <574..737 CDD:187754 43/214 (20%)
leucine-rich repeat 575..600 CDD:275381 1/24 (4%)
leucine-rich repeat 601..626 CDD:275381 6/27 (22%)
leucine-rich repeat 627..652 CDD:275381 5/24 (21%)
leucine-rich repeat 653..677 CDD:275381 10/44 (23%)
leucine-rich repeat 678..704 CDD:275381 5/32 (16%)
leucine-rich repeat 707..732 CDD:275381 9/40 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.