DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11044 and RAD7

DIOPT Version :9

Sequence 1:NP_611456.1 Gene:CG11044 / 37281 FlyBaseID:FBgn0034484 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_012586.1 Gene:RAD7 / 853512 SGDID:S000003813 Length:565 Species:Saccharomyces cerevisiae


Alignment Length:205 Identity:47/205 - (22%)
Similarity:81/205 - (39%) Gaps:42/205 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 IGSRIRTLVYHFPCNMSQPNDPEGIKLFGTGGQLLRVLKELLLR----LTDLHTLK-LVDFVLER 231
            :.....:|...:|.|....||...|.|.   ||:.|.|::|:|.    |||...:. |..|:.|:
Yeast   364 VNDEFHSLCIEYPFNEEDVNDEIIINLL---GQIGRTLRKLVLNGCIDLTDSMIINGLTAFIPEK 425

  Fly   232 --------YEANHLLDEVVCSCCTKMRVLNLVNVTTMHCPIMHVG------LFLN-----LQVLT 277
                    .|::.:..:.:....:|:.:.||:..:...|  :.:|      |.||     |:.|.
Yeast   426 CPLEVLSLEESDQITTDSLSYFFSKVELNNLIECSFRRC--LQLGDMAIIELLLNGARDSLRSLN 488

  Fly   278 I-SPQNIDDDVLSLLADTKLRHLHL-LQNCYTPSHLTISACGVKAWRNVKKTNPRLRV-HLRLEN 339
            : |.:.:..:....||...|.:|.| ...|...|  .|...|        :.||.|.| .:..:|
Yeast   489 LNSLKELTKEAFVALACPNLTYLDLGFVRCVDDS--VIQMLG--------EQNPNLTVIDVFGDN 543

  Fly   340 LTDGEVVLQP 349
            |...:..::|
Yeast   544 LVTEKATMRP 553

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG11044NP_611456.1 F-box-like 51..94 CDD:289689
RAD7NP_012586.1 AMN1 228..440 CDD:187754 20/78 (26%)
leucine-rich repeat 236..261 CDD:275381
leucine-rich repeat 262..287 CDD:275381
leucine-rich repeat 288..340 CDD:275381