DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11044 and AMN1

DIOPT Version :9

Sequence 1:NP_611456.1 Gene:CG11044 / 37281 FlyBaseID:FBgn0034484 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_009716.1 Gene:AMN1 / 852455 SGDID:S000000362 Length:549 Species:Saccharomyces cerevisiae


Alignment Length:147 Identity:38/147 - (25%)
Similarity:56/147 - (38%) Gaps:32/147 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 KAWRNVKKTNPRL-------RVHLRLENLTDGEVVLQPEAPVHSITYCAPQ-TRIRAELLVRMVD 375
            :.|.||  |.|.|       .||...|.|...:...|...|.|.|.:...| |:...|.|.||..
Yeast   249 RLWLNV--TRPFLFKSLHFKSVHNFKEFLRTSQETTQVMRPSHFILHKLHQVTQPDIERLSRMEC 311

  Fly   376 HYKSTLAVYGHELLPRFSSPKPFHSRIDSLMLLMCRQCFNVDTLII--REKVSTSTLLLIAKTAK 438
            .....|..|   :.||.:.|..:...:..|           :.|||  .:.:..:.||.::::..
Yeast   312 QNLKWLEFY---VCPRITPPLSWFDNLHKL-----------EKLIIPGNKNIDDNFLLRLSQSIP 362

  Fly   439 NLQHLHVRRFAVILRCD 455
            ||:||      |:..||
Yeast   363 NLKHL------VLRACD 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11044NP_611456.1 F-box-like 51..94 CDD:289689
AMN1NP_009716.1 AMN1 285..509 CDD:187754 27/109 (25%)
leucine-rich repeat 314..337 CDD:275381 5/25 (20%)
leucine-rich repeat 338..363 CDD:275381 6/35 (17%)
leucine-rich repeat 364..389 CDD:275381 6/16 (38%)
leucine-rich repeat 390..417 CDD:275381
leucine-rich repeat 418..443 CDD:275381
leucine-rich repeat 444..471 CDD:275381
leucine-rich repeat 472..493 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.