DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11044 and KDM2B

DIOPT Version :9

Sequence 1:	NP_611456.1	Gene:	CG11044 / 37281	FlyBaseID:	FBgn0034484	Length:	511	Species:	Drosophila melanogaster
Sequence 2:	XP_011537169.1	Gene:	KDM2B / 84678	HGNCID:	13610	Length:	1353	Species:	Homo sapiens

Alignment Length:	126	Identity:	25/126 - (19%)
Similarity:	43/126 - (34%)	Gaps:	46/126 - (36%)

- Green bases have known domain annotations that are detailed below.

  Fly    22 WKIDGDEKACYIDVDEDEDQDTENMIESNWRYLPDLVLEQIFTYLTPKERYYAGLVCRQWYRAFY 86
            |.:.|.:...::....:..|..|              |:|.:|:..|.          .|..|.|
Human   277 WVLSGKQSDIFLGDRVERCQRIE--------------LKQGYTFFIPS----------GWIHAVY 317

  Fly    87 LP----TVWNNFL-------------VDDRTLTKPKFNYYSGWQFC---LDHMRTQFCLSR 127
            .|    ....|.|             ::|||..:|||.|...::.|   |:  |..:|:::
Human   318 TPVDSLVFGGNILHSFNVPMQLRIYEIEDRTRVQPKFRYPFYYEMCWYVLE--RYVYCVTQ 376

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11044	NP_611456.1	F-box-like	51..94	CDD:289689	8/46 (17%)
KDM2B	XP_011537169.1	JmjC	182..257	CDD:214721
		cupin_like	229..335	CDD:304367	14/81 (17%)
		zf-CXXC	<615..651	CDD:251032
		PHD_KDM2B	661..722	CDD:277114
		F-box-like	1071..1111	CDD:289689
		leucine-rich repeat	1105..1129	CDD:275381
		AMN1	1121..1310	CDD:187754
		leucine-rich repeat	1130..1153	CDD:275381
		leucine-rich repeat	1154..1177	CDD:275381
		leucine-rich repeat	1178..1217	CDD:275381
		leucine-rich repeat	1218..1242	CDD:275381
		leucine-rich repeat	1243..1272	CDD:275381
		leucine-rich repeat	1273..1297	CDD:275381
		leucine-rich repeat	1298..1323	CDD:275381
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1947
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900