DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11044 and amn1

DIOPT Version :9

Sequence 1:NP_611456.1 Gene:CG11044 / 37281 FlyBaseID:FBgn0034484 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001038919.1 Gene:amn1 / 751744 ZFINID:ZDB-GENE-060825-13 Length:249 Species:Danio rerio


Alignment Length:177 Identity:36/177 - (20%)
Similarity:61/177 - (34%) Gaps:62/177 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 DLHTLKLVDFVLERYEANHLLD--------------EVVCSCCTKMRVLNLVNVTTM-------- 260
            ||...|:.|..|::..:.||..              ||:...|..::|::|...|.:        
Zfish    63 DLQNCKISDSALKQINSLHLRTILLRGCAEITSEGLEVLAPRCPYLQVVDLTGCTAVTDSGIQAL 127

  Fly   261 --HCPIMHVGLFLNLQVLTISPQNIDDDVLSLLADTKLRHLHLLQNCYTPSHLT----------I 313
              ||..:.|........|:      |..:|.|..:.|:  ||.:.  ::.:.:|          :
Zfish   128 ARHCKCLEVISLRGCSALS------DKALLELGGNCKM--LHSIY--FSGTEVTDQGVIGLATGV 182

  Fly   314 SACGVKAWRNVKKTNPRLRVHLRLENLTDGEVVLQPEAPVHSITYCA 360
            .:|.:|..:.|           |..||||..|..       .:|.||
Zfish   183 CSCSLKELQMV-----------RCRNLTDLAVTA-------VLTNCA 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11044NP_611456.1 F-box-like 51..94 CDD:289689
amn1NP_001038919.1 AMN1 33..248 CDD:187754 36/177 (20%)
leucine-rich repeat 59..72 CDD:275381 3/8 (38%)
leucine-rich repeat 82..107 CDD:275381 4/24 (17%)
leucine-rich repeat 108..133 CDD:275381 5/24 (21%)
leucine-rich repeat 134..159 CDD:275381 5/30 (17%)
leucine-rich repeat 160..186 CDD:275381 3/27 (11%)
leucine-rich repeat 187..212 CDD:275381 11/43 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.