DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11044 and Fbxl15

DIOPT Version :9

Sequence 1:NP_611456.1 Gene:CG11044 / 37281 FlyBaseID:FBgn0034484 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001365702.1 Gene:Fbxl15 / 68431 MGIID:1915681 Length:336 Species:Mus musculus


Alignment Length:299 Identity:67/299 - (22%)
Similarity:99/299 - (33%) Gaps:104/299 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 QFCLSRIGRY-----VRGIEFRPWHSFNNIFQFMTMLTWNIDKGREVNPDTQFIGIGSRIRTLVY 181
            |..|:|:.|:     .||.|.||.|:          ..|       |.|..:           :.
Mouse    56 QLHLARLRRFDAAQVSRGPEPRPRHA----------PAW-------VPPSPR-----------LQ 92

  Fly   182 HFPCNMSQPNDPEGIKLFGTGGQLLRVLKELLLRLTD-LHTLKLVDF-----------VLERYEA 234
            ..||....|:.|.      .|.|:.|.....|||..: |..|.|...           ||.|   
Mouse    93 ASPCCAVNPSRPR------VGPQIPRAALARLLRDAEGLQELALAPCHEWLSDEDLVPVLAR--- 148

  Fly   235 NHLLDEVVCSCCTKM--RVL--------NLVNVTTMHCPIMHVGLFLN--------LQVLTISP- 280
            |..|..|..:.|.::  |.|        .|..::..||..:. ||.|.        |:.|.::. 
Mouse   149 NPQLRSVALAGCGQLSRRALGALAEGCPRLQRLSLAHCDWVD-GLALRGLADRCPALEELDLTAC 212

  Fly   281 QNIDDDVLSLLADTK---LRHL--------------HLLQNCYTPSHLTISAC---GVKAWRNVK 325
            :.:.|:.:..||..:   ||.|              .|.:||....||.::.|   |....|.:.
Mouse   213 RQLKDEAIVYLAQRRGAGLRSLSLAVNANVGDTAVQELARNCPQLEHLDLTGCLRVGSDGVRTLA 277

  Fly   326 KTNPRLR-VHLR---------LENLTDGEVVLQPEAPVH 354
            :..|.|| :.:|         |..|....|.:..|.|:|
Mouse   278 EYCPALRSLRVRHCHHVAEPSLSRLRKRGVDIDVEPPLH 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11044NP_611456.1 F-box-like 51..94 CDD:289689
Fbxl15NP_001365702.1 F-box 18..55 CDD:395521
leucine-rich repeat 125..151 CDD:275381 7/28 (25%)
leucine-rich repeat 152..177 CDD:275381 5/24 (21%)
AMN1 <175..>304 CDD:187754 28/129 (22%)
leucine-rich repeat 178..203 CDD:275381 6/25 (24%)
leucine-rich repeat 204..230 CDD:275381 5/25 (20%)
leucine-rich repeat 231..256 CDD:275381 6/24 (25%)
leucine-rich repeat 257..281 CDD:275381 5/23 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.