DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11044 and FBXL8

DIOPT Version :9

Sequence 1:NP_611456.1 Gene:CG11044 / 37281 FlyBaseID:FBgn0034484 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_060848.2 Gene:FBXL8 / 55336 HGNCID:17875 Length:374 Species:Homo sapiens


Alignment Length:441 Identity:101/441 - (22%)
Similarity:143/441 - (32%) Gaps:166/441 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LPDLVLEQIFTYLTPKERYYAGLVCRQWYRAFYLPTVWNNFLV----DDRTLTKPKFNYYSGWQF 114
            ||:.||..||.:|:.::|..|..|||.|..|.....||::..:    :...:..|   |.|.   
Human     8 LPEEVLALIFRHLSLRDRAAAARVCRAWAAAATCSAVWHDTKISCECELEGMLPP---YLSA--- 66

  Fly   115 CLDH---MRTQFCLSRIGRYVRGIEFRPWHSFNNIFQFMTMLTWNIDKGREVNPDTQFIGIGSRI 176
            ||||   :|.:|..||          :|  |.....:.:.:|.                |....:
Human    67 CLDHIHNLRLEFEPSR----------KP--SRRAAIELLMVLA----------------GRAPGL 103

  Fly   177 RTLVYHFPCNMSQPNDPEGIKLFGTGGQLLRVLKELLLRLTDLHTLKLVDFVLERYEANHLLDEV 241
            |.|  ...|...:|       ||..|..:|                          ||.|    .
Human   104 RGL--RLECRGEKP-------LFDAGRDVL--------------------------EAVH----A 129

  Fly   242 VCSCCTKMRVLN-----------LVNVTTMHCPIMHVGLFLNLQVL--TISPQNIDDDVLSLL-A 292
            ||...:::|.|:           ||......||.:| .|||:...|  ::.|    ..||.|| |
Human   130 VCGAASQLRHLDLRRLSFTLDDALVLQAARSCPELH-SLFLDNSTLVGSVGP----GSVLELLEA 189

  Fly   293 DTKLR--HLHLLQ----------------------NCYTPSHLTISACGVKAWRNVKKTNPRLRV 333
            ..:||  .|||..                      .|..|.....|....:||..:::.:|.|.|
Human   190 CPRLRALGLHLASLSHAILEALAAPDRAPFALLALRCACPEDARASPLPNEAWVALRRRHPGLAV 254

  Fly   334 HLRLENLTDGEV---VLQPEAPV---------------------HSITYCAPQTRIRA------- 367
            .|.||.....|.   ||||..||                     ::.|.||.:.|..|       
Human   255 ELELEPALPAESVTRVLQPAVPVAALRLNLSGDTVGPVRFAAHHYAATLCALEVRAAASAELNAA 319

  Fly   368 --ELLVRMVD----HYKSTLAVYGHELLPRFSSPKPFHSRIDSLMLLMCRQ 412
              ||..|...    |   ...|..|.:|..|.:..|   |:.:..|.:.|:
Human   320 LEELAARCAALREVH---CFCVVSHSVLDAFRAHCP---RLRTYTLKLTRE 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11044NP_611456.1 F-box-like 51..94 CDD:289689 16/39 (41%)
FBXL8NP_060848.2 leucine-rich repeat 103..136 CDD:275381 13/71 (18%)
LRR_RI <132..>212 CDD:330982 22/84 (26%)
leucine-rich repeat 137..163 CDD:275381 5/25 (20%)
leucine-rich repeat 164..192 CDD:275381 11/32 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1216869at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.