DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11044 and FBXL12

DIOPT Version :9

Sequence 1:NP_611456.1 Gene:CG11044 / 37281 FlyBaseID:FBgn0034484 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_016882401.1 Gene:FBXL12 / 54850 HGNCID:13611 Length:343 Species:Homo sapiens


Alignment Length:233 Identity:45/233 - (19%)
Similarity:79/233 - (33%) Gaps:77/233 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 RVLKELLLR--LTDLHTLKLVDFVLERYEANHLLDEVV------C----SCCTKMRVLNLVNVTT 259
            :|:..||.|  .:.||:|::..::....:|..|...::      |    ..|..:..|::|.:|:
Human    74 KVMWHLLRRYMASRLHSLRMGGYLFSGSQAPQLSPALLRALGQKCPNLKRLCLHVADLSMVPITS 138

  Fly   260 M----------HCPIMHVGL----------FLNLQVLTISPQNIDDDVLSLLADTKLRHLHL--- 301
            :          .|.|....|          .|...||...|...|:.:..|.....||.|.|   
Human   139 LPSTLRTLELHSCEISMAWLHKQQDPTVLPLLECIVLDRVPAFRDEHLQGLTRFRALRSLVLGGT 203

  Fly   302 -----------LQNCYTPSHLTISACGVKA----------WRNVKKTNPRLRVHLR--------- 336
                       ||.......|.:..|.:.|          .|:|:|    :|:.:|         
Human   204 YRVTETGLDAGLQELSYLQRLEVLGCTLSADSTLLAISRHLRDVRK----IRLTVRGLSAPGLAV 264

  Fly   337 ------LENLTDGEVVLQPE--APVHSITYCAPQTRIR 366
                  ||:|.....::.||  :|...::.|....::|
Human   265 LEGMPALESLCLQGPLVTPEMPSPTEILSSCLTMPKLR 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11044NP_611456.1 F-box-like 51..94 CDD:289689
FBXL12XP_016882401.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.