DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11044 and Fbxl8

DIOPT Version :9

Sequence 1:NP_611456.1 Gene:CG11044 / 37281 FlyBaseID:FBgn0034484 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001102598.1 Gene:Fbxl8 / 498941 RGDID:1566420 Length:374 Species:Rattus norvegicus


Alignment Length:385 Identity:91/385 - (23%)
Similarity:132/385 - (34%) Gaps:102/385 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LPDLVLEQIFTYLTPKERYYAGLVCRQWYRAFYLPTVWNNFLV----DDRTLTKPKFNYYSGWQF 114
            ||:.||..||..|..::|..|..|||.|..|.....||.:..:    :...|..|      |...
  Rat     8 LPEEVLGLIFRDLPLRDRAVAARVCRAWAAAATNSAVWYDTSISCDCELENLLPP------GLSA 66

  Fly   115 CLDHMRTQFCLSRIGRYVRGIEFRPWH--SFNNIFQFMTMLTWNIDKGREVNPDTQFIGIGSRIR 177
            ||||:..   ||        :|:.|..  |.....:.:|.|.                ....|:|
  Rat    67 CLDHIHN---LS--------LEYEPSKKPSRRTATELLTALA----------------SRAPRLR 104

  Fly   178 TLVYHFPCNMSQPNDPEGIKLFGTGGQLLRVLKELLLRLTDLHTLKLVDFVLERYEANHL---LD 239
            .|  ...|...:|       ||..|..:|..          |||:......|...:..||   :|
  Rat   105 GL--RLECRGEKP-------LFDAGRDILGA----------LHTVCGAAHQLRHLDLRHLPYTVD 150

  Fly   240 EV----VCSCCTKMRVLNLVNVTTMH-------------CPIMHVGLFLNLQVLTISPQNIDDDV 287
            :.    |...|.::|.|.|.|...::             ||        :|:.|.:...::....
  Rat   151 DTLVLKVAGGCPELRSLFLDNHALVNSVQPASVLRLLEACP--------HLRALGLHLASMSRAA 207

  Fly   288 LSLLADTKLRHLHLLQ-NCYTPSHLTISACGVKAWRNVKKTNPRLRVHLRLENLTDGEVV---LQ 348
            |.|||........||. .|..|.....|....:||..:...:|.|:|.|.||.:...|.|   ||
  Rat   208 LELLAAPHRAPFTLLALKCACPEDARASPLPDEAWATLTCYHPGLKVELELEPVLPDEAVSRILQ 272

  Fly   349 PEAPVHSITYCAPQTRIRAELL--VRM-VDHYKSTLAVYGHELLPRFSSPKPFHSRIDSL 405
            |..||..:     :..:..:.:  ||. ..||..||    ..|..|.|:....|:.::.|
  Rat   273 PAVPVAVL-----RLNLSGDTVGPVRFAARHYAETL----RALEVRASASTELHTALEEL 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11044NP_611456.1 F-box-like 51..94 CDD:289689 16/39 (41%)
Fbxl8NP_001102598.1 F-box-like 5..>34 CDD:403981 11/25 (44%)
leucine-rich repeat 103..136 CDD:275381 11/51 (22%)
leucine-rich repeat 137..163 CDD:275381 6/25 (24%)
leucine-rich repeat 164..192 CDD:275381 6/35 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1216869at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.