DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11044 and Fbxl16

DIOPT Version :9

Sequence 1:NP_611456.1 Gene:CG11044 / 37281 FlyBaseID:FBgn0034484 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_038942467.1 Gene:Fbxl16 / 494223 RGDID:1309127 Length:488 Species:Rattus norvegicus


Alignment Length:433 Identity:90/433 - (20%)
Similarity:142/433 - (32%) Gaps:152/433 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 VLEQIFTYLTPKERYYAGLVCRQWYRAFYLPTVWNNFLVDDRTLT-----KPKFNYYSGWQ---- 113
            :|..:|.|.:..|:.....||:.|.|..|.|..|..       ||     |..:|...|.:    
  Rat   101 ILNGLFWYFSACEKCILAQVCKAWRRVLYQPKFWAG-------LTPVLHAKELYNVLPGGEKEFV 158

  Fly   114 ------------FCLDHMR--------TQFCLSRIGRYVRGIEFRPWHSFNNIFQFMTMLTWNID 158
                        |||..:.        ..:.||:.|  |:.:..:           .:.:|   |
  Rat   159 NLQGFAARGFEGFCLVGVSDLDICEFIDNYSLSKKG--VKAMSLK-----------RSTIT---D 207

  Fly   159 KGREV----------------NPDTQ---FIGIGSRIRTLVYHFPCNMSQPNDPEGIKLFGTGGQ 204
            .|.||                |..|:   :..:.:||.:|......|::.    :.|...   .|
  Rat   208 AGLEVMLEQMQGVVRLELSGCNDFTEAGLWSSLSARITSLSVSDCINVAD----DAIAAI---SQ 265

  Fly   205 LLRVLKELLLRLTDLHTLKLVDFVLERYEANHLLDEVVCSCCTKMRVLNLVNVTTMHCPIMHVGL 269
            ||..|.||.|:...:....|..|...:..:.|.|..:.|...|...|:|:|:...          
  Rat   266 LLPNLAELSLQAYHVTDTALAYFTARQGHSTHTLRLLSCWEITNHGVVNVVHSLP---------- 320

  Fly   270 FLNLQVLTISP-QNIDDDVLSLLADT--KLRHLHLLQNC--YTPSHLTISACGVKAWRNVKKTNP 329
              ||..|::|. ..:.||.:.|:|:.  |||.|. |..|  .|...|...||.:.          
  Rat   321 --NLTSLSLSGCSKVTDDGVELVAENLRKLRSLD-LSWCPRITDMALEYVACDLH---------- 372

  Fly   330 RLRVHLRLENLTDGEVVLQPEAPVHSITYCAPQTRIRAELLVRMVD---HYKSTLAVYGHELLPR 391
                  |||     |:||......::..:|           ||:.|   .|.||::         
  Rat   373 ------RLE-----ELVLDRCTHPYTPGWC-----------VRITDTGLSYLSTMS--------- 406

  Fly   392 FSSPKPFHSRIDSLMLLMCRQCFNVDTLIIREKVSTSTLLLIA 434
                        ||..|..|.|..|....::..::..:|.|::
  Rat   407 ------------SLRSLYLRWCCQVQDFGLKHLLAMRSLRLLS 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11044NP_611456.1 F-box-like 51..94 CDD:289689 11/35 (31%)
Fbxl16XP_038942467.1 leucine-rich repeat 195..219 CDD:275381 6/37 (16%)
AMN1 201..422 CDD:187754 65/307 (21%)
leucine-rich repeat 220..243 CDD:275381 2/22 (9%)
leucine-rich repeat 244..269 CDD:275381 7/31 (23%)
leucine-rich repeat 270..321 CDD:275381 13/62 (21%)
leucine-rich repeat 322..347 CDD:275381 7/24 (29%)
leucine-rich repeat 348..373 CDD:275381 9/41 (22%)
leucine-rich repeat 374..407 CDD:275381 12/69 (17%)
leucine-rich repeat 408..427 CDD:275381 5/18 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.