DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11044 and Fbxl7

DIOPT Version :9

Sequence 1:NP_611456.1 Gene:CG11044 / 37281 FlyBaseID:FBgn0034484 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_795933.2 Gene:Fbxl7 / 448987 MGIID:3052506 Length:491 Species:Mus musculus


Alignment Length:442 Identity:88/442 - (19%)
Similarity:158/442 - (35%) Gaps:145/442 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LPDLVLEQIFTYLTPKERYYAGLVCRQWYRAFYLPTVWNNFLVDDRTLTKPKFNYYSGWQFCLDH 118
            |||..:.|||::|...:......|||:||...:.|.:|....:...|:                 
Mouse   117 LPDHSMVQIFSFLPTNQLCRCARVCRRWYNLAWDPRLWRTIRLTGETI----------------- 164

  Fly   119 MRTQFCLSRIGRYVRGIEFRPWHSFNNIFQFMTMLTWNIDKGREVNPDTQFIGIGSRIRTLVYHF 183
                                      |:.:.:.:||      |.:..||..:             
Mouse   165 --------------------------NVDRALKVLT------RRLCQDTPNV------------- 184

  Fly   184 PCNMSQPNDPEGIKLFGTGGQLLRVLKELLLRLTD--LHTLKLVDFVLERYE-------ANHLLD 239
             |.|.:.....|.:                 ||||  |:|:......|.|.|       :|..:.
Mouse   185 -CLMLETVIVSGCR-----------------RLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVF 231

  Fly   240 EVVCSC----------CTKMRVLNLVNVTTMHCPIMHVGLFLNLQVLTISPQNI-DDDVLSLLAD 293
            :||..|          |:|:..::|....::....:| |..::::.|.::...: :|:.|..:|.
Mouse   232 DVVSLCPNLEHLDVSGCSKVTCISLTREASIKLSPLH-GKQISIRYLDMTDCFVLEDEGLHTIAA 295

  Fly   294 --TKLRHLHLLQ--------------NCYTPSHLTISAC------GVKAWRNVKKTNPRLRVHLR 336
              |:|.||:|.:              .|.:...|::|.|      |:   |.:.|...||| :|.
Mouse   296 HCTQLTHLYLRRCVRLTDEGLRYLVIYCTSIKELSVSDCRFVSDFGL---REIAKLESRLR-YLS 356

  Fly   337 LEN---LTDGEVVLQPEAPVHSITYCAPQTRIRAELLVRMVDHYKSTLAVYGHEL--LPRFSSPK 396
            :.:   :||..:       .:...||:....:.|.....:.||....||....:|  |.....|.
Mouse   357 IAHCGRITDVGI-------RYVAKYCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSLDIGKCPL 414

  Fly   397 PFHSRIDSLMLLMCRQCFNVDTLIIR--EKVSTSTLLLIAKTAKNLQHLHVR 446
            ...:.::||.|    .|||:..|.::  |.::...|.::|....:||.|:|:
Mouse   415 VSDTGLESLAL----NCFNLKRLSLKSCESITGQGLQIVAANCFDLQMLNVQ 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11044NP_611456.1 F-box-like 51..94 CDD:289689 14/39 (36%)
Fbxl7NP_795933.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..79
F-box-like 114..160 CDD:289689 14/42 (33%)
leucine-rich repeat 129..151 CDD:275381 6/21 (29%)
leucine-rich repeat 154..187 CDD:275381 9/95 (9%)
AMN1 <185..366 CDD:187754 42/202 (21%)
LRR 1 185..210 9/41 (22%)
leucine-rich repeat 188..213 CDD:275381 7/41 (17%)
LRR 2 211..236 6/24 (25%)
leucine-rich repeat 214..234 CDD:275381 4/19 (21%)
LRR 3 237..262 4/24 (17%)
leucine-rich repeat 240..273 CDD:275381 5/33 (15%)
LRR 4 271..296 4/24 (17%)
leucine-rich repeat 274..299 CDD:275381 4/24 (17%)
AMN1 297..464 CDD:187754 42/181 (23%)
LRR 5 297..322 5/24 (21%)
leucine-rich repeat 300..325 CDD:275381 5/24 (21%)
LRR 6 323..348 6/27 (22%)
leucine-rich repeat 326..351 CDD:275381 6/27 (22%)
LRR 7 349..374 6/32 (19%)
leucine-rich repeat 352..377 CDD:275381 7/32 (22%)
LRR 8 375..400 6/24 (25%)
leucine-rich repeat 378..403 CDD:275381 5/24 (21%)
LRR 9 401..426 6/28 (21%)
leucine-rich repeat 404..429 CDD:275381 7/28 (25%)
LRR 10 427..452 7/24 (29%)
leucine-rich repeat 430..453 CDD:275381 4/22 (18%)
leucine-rich repeat 456..480 CDD:275381 4/7 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.