DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11044 and FipoQ

DIOPT Version :9

Sequence 1:NP_611456.1 Gene:CG11044 / 37281 FlyBaseID:FBgn0034484 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster


Alignment Length:537 Identity:108/537 - (20%)
Similarity:197/537 - (36%) Gaps:125/537 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 QLEVMQKAGWKIDGDEKACYIDVDEDEDQDTENMIESNWRYLPDLVLEQIFTYLTPKERYYAGLV 77
            ||.|.....:..||..::.:.|...::              |||.||..||:||:.:|......:
  Fly    10 QLAVEASQVYLSDGTVRSPFADTTIEK--------------LPDKVLLHIFSYLSHREICRLARI 60

  Fly    78 CRQWYRAFYLPTVWNNFLVDDRTLTKPKFNYYSGWQFCLDHMRTQFCLSRIGRYVRGIEF----- 137
            ||:|.:..|...:|.|..:      :|:   .||.......|..|....|.|..:|.||.     
  Fly    61 CRRWRQIAYDTRLWKNVSL------RPE---VSGLHVGSLEMLLQLISVRFGPTLRYIELPIELI 116

  Fly   138 --RPWHSFNNIFQFMTMLTWNIDKGREVNPDTQFIGIGSRIRTLVYHFPCNMSQPNDPEG----I 196
              ...|..:.....:|.:..:.....:::..::.....:::|   |...| :|:....||    |
  Fly   117 THTVLHELSAKCPNLTHMLLDFSTAMQLHDFSEMQAFPTKLR---YMCVC-LSEVIFMEGFMRKI 177

  Fly   197 KLFGTGGQLLRVL---------KELLLRLTDLHTLKLVD---FVLERYEANHLLD---EVVCSCC 246
            ..|..|.::|.::         :|.:..:.::|.||...   .|:..|..|.:.|   :...|.|
  Fly   178 YNFINGLEVLHLIGTYEKCEEEEEEIYEVINVHKLKSATPNLRVINLYGINFIDDSHIDAFSSNC 242

  Fly   247 TKMRVL--NLVNVTT-------------MHCPIMHVGLFLN-------------LQVLTISPQNI 283
            .::..|  |..|..|             :.|.:|: |..|.             ||.|.|:..::
  Fly   243 IQLECLAVNFCNKVTGSTLKTLIQRSKRLTCLLMN-GTSLKSEFVMQAEWDKCALQELDITATDL 306

  Fly   284 DD----DVLSLLADTKLRHLHLLQNCYTPSHLTISACGVKAWRNVKKTNPRLRVHL-RLENLTDG 343
            ..    |:||.:...|......: |.:..|.|       |.|.....|...:.:.| ..:|::|.
  Fly   307 STECLVDMLSRIPSLKFLSAGQI-NGFNDSVL-------KQWMESGTTRSLISLDLDSSDNISDE 363

  Fly   344 EVVLQPEAPVHSITYC--APQTRIRAELLVRMVDHYKSTLAVYGH-ELLPRFSSPK-PFHSRIDS 404
            .::...:...|.::.|  :....|..:|       :.|.|.:.|: :::...::.| ..:..:|.
  Fly   364 GLLKFIQRQGHQLSACCLSGMPHITDQL-------WMSILPLLGNCKIIVMGTAEKLGVNIHVDQ 421

  Fly   405 LMLLMCRQCFNVDTLIIREKVSTSTLLLIAKTAKNLQHLHVRRFAVILRC----DWPRHPEWSNE 465
            ||..:...|.|::.|.:|  .....|....|:.|.:..|.|:  .:.|||    |        ..
  Fly   422 LMDTIASNCGNLERLELR--WDPDNLRFSDKSQKAIDILRVK--CLKLRCMVLSD--------GR 474

  Fly   466 FYAWLKRNSRSYEAVER 482
            :|..:|.|   :|..:|
  Fly   475 YYETVKAN---FERADR 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11044NP_611456.1 F-box-like 51..94 CDD:289689 15/42 (36%)
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 16/65 (25%)
leucine-rich repeat 131..156 CDD:275381 1/24 (4%)
leucine-rich repeat 157..175 CDD:275381 6/21 (29%)
leucine-rich repeat 219..244 CDD:275381 6/24 (25%)
leucine-rich repeat 245..270 CDD:275381 4/24 (17%)
leucine-rich repeat 271..295 CDD:275381 4/24 (17%)
leucine-rich repeat 296..320 CDD:275381 7/23 (30%)
leucine-rich repeat 321..348 CDD:275381 7/34 (21%)
leucine-rich repeat 349..375 CDD:275381 3/25 (12%)
leucine-rich repeat 376..403 CDD:275381 6/33 (18%)
leucine-rich repeat 405..432 CDD:275381 5/26 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.