DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11044 and Fbl6

DIOPT Version :9

Sequence 1:NP_611456.1 Gene:CG11044 / 37281 FlyBaseID:FBgn0034484 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_610665.2 Gene:Fbl6 / 36201 FlyBaseID:FBgn0033609 Length:720 Species:Drosophila melanogaster


Alignment Length:447 Identity:91/447 - (20%)
Similarity:155/447 - (34%) Gaps:122/447 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QKAGWKIDGDEKACYIDVDEDEDQDTENMIE-SNW-RYLPDLVLEQIFTYLTPKE-----RYYAG 75
            :|.|....|.||.  :....|..:...:.:| |.| :.||:.||.:||.:....:     .:..|
  Fly   257 KKGGGGGSGGEKK--VSTSPDAAEAAGDPVEQSVWAQKLPEEVLFRIFEHAVDTQGCLPTLFRLG 319

  Fly    76 LVCRQWYRAFYLPTVWNNF----LVDDRTLTKPKFNYY--SGWQFCLDHMRTQFCLSRIGRY--- 131
            .||..|.:....||:|...    .|.::..|:.|..::  :....|.|...:.:.:|.|..:   
  Fly   320 RVCSLWRQVSLRPTLWRTMDLTTWVKEKYRTELKLKWFVDNRCSACTDLNVSNWKISDINCFLAK 384

  Fly   132 -------VRGIEFRPWHSFNNIFQFMTMLTWNIDK---------GREVNPDTQFIGIGSRIRTLV 180
                   :.||....|..|.:  ..:|.|..|:.|         ..|:|.....:|:.|.     
  Fly   385 LSSGCPNLAGITLSGWKGFTS--DHLTYLVDNMHKLQRLDLSSINVEMNASKSAVGVNSL----- 442

  Fly   181 YHFPCNMSQPNDPEGIKLFGTGGQLLRVLKELLLRLTDLHTLKLVDFVLERYEAN-----HLLDE 240
                ||..|........|:....:|..:.:.:.:..|....|.|:|......:|.     |:  |
  Fly   443 ----CNALQTMGSRLTHLYLAHNRLAGIPQIVGILSTHCPNLTLLDLSNVTTQATSHGVLHI--E 501

  Fly   241 VVCSCCTKMRVLNLVN-----VTTMHCPIMHVGLF-----LNLQVLTISPQNIDDDVLS--LLAD 293
            .:...|.|::||.:.|     .|.....||....|     |::..||...:.|.||.|.  |.:.
  Fly   502 KLQRGCQKLKVLRVTNSHITPSTASMQEIMDSPGFPELEELSVAALTDESRIISDDHLQRILKSS 566

  Fly   294 TKLRHLHLLQNC-------------YTPSHLTISACGVK-----------------------AWR 322
            :||:.|. ::||             :...||.:|.|.|.                       ||.
  Fly   567 SKLKLLD-VRNCTRLTHESLIRLPAWDIKHLFLSGCSVTRDMGSGLELIASKWAHSLIELDLAWA 630

  Fly   323 NVK--------------KTNPRLRVHLRLENLTDGEVVLQPEAPVHSITYCAPQTRI 365
            |::              :.:|...::|...:::|       ||....:|.|...:.|
  Fly   631 NMQQPIDNALRALAEKGRDSPLAHLNLCGSSVSD-------EAVKEILTNCQNMSSI 680

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11044NP_611456.1 F-box-like 51..94 CDD:289689 14/48 (29%)
Fbl6NP_610665.2 F-box-like 293..341 CDD:289689 13/47 (28%)
leucine-rich repeat 365..391 CDD:275381 4/25 (16%)
leucine-rich repeat 392..417 CDD:275381 7/26 (27%)
leucine-rich repeat 418..445 CDD:275381 5/35 (14%)
leucine-rich repeat 453..471 CDD:275381 2/17 (12%)
leucine-rich repeat 480..509 CDD:275381 7/30 (23%)
leucine-rich repeat 510..538 CDD:275381 7/27 (26%)
leucine-rich repeat 539..579 CDD:275381 13/40 (33%)
leucine-rich repeat 580..621 CDD:275381 5/40 (13%)
leucine-rich repeat 622..649 CDD:275381 3/26 (12%)
leucine-rich repeat 652..676 CDD:275381 6/30 (20%)
leucine-rich repeat 677..698 CDD:275381 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.