DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11044 and fbxl14b

DIOPT Version :9

Sequence 1:NP_611456.1 Gene:CG11044 / 37281 FlyBaseID:FBgn0034484 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001015043.1 Gene:fbxl14b / 324835 ZFINID:ZDB-GENE-030131-3556 Length:400 Species:Danio rerio


Alignment Length:409 Identity:79/409 - (19%)
Similarity:134/409 - (32%) Gaps:136/409 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 VLEQIFTYLTPKERYYAGLVCRQWYRAFYLPTVWN---------------------------NFL 95
            :|..||:||..:::.....||..|..|.|..:||.                           ..|
Zfish    12 ILAMIFSYLDVRDKGRVAQVCTAWRDASYHKSVWRGVEAKLHLRRANPSLFPSLQARGIRRVQIL 76

  Fly    96 VDDRTLT-----KPKFN--YYSGWQFCLDH---------------MRTQFC-------LSRIGRY 131
            ...|:|:     .|...  ..||.....|:               :....|       |.||.:|
Zfish    77 SLRRSLSYVIQGMPNIESLNLSGCYNLTDNGLGHAFVQEIPSLRVLNLSLCKQITDSSLGRIAQY 141

  Fly   132 VRGIEFRPWHSFNNIFQF-MTMLTWNIDKGREVN----PDTQFIGIGSRIRTLVYHFPCNMSQPN 191
            ::.:|.......:||... :.::.|.:.:.:.:|    .....:|||        |.        
Zfish   142 LKNLEVLELGGCSNITNTGLLLIAWGLHRLKSLNLRSCRHVSDVGIG--------HL-------- 190

  Fly   192 DPEGIKLFGTGGQLLRVLKELLL----RLTDLHTLKLVDFVLERYEANHLLDEVVCSCCTKMRVL 252
              .|:......|.|  .|:.|.|    :|||| :||.:...|.:.:   :|:...|...:...::
Zfish   191 --AGMTRSAAEGCL--SLEYLTLQDCQKLTDL-SLKHISKGLTKLK---VLNLSFCGGISDAGMI 247

  Fly   253 NLVNVTTM------HCP------IMHVGL-FLNLQVLTIS-PQNIDDDVLSLLADTKLRHLHLLQ 303
            :|.::|::      .|.      |||:.: .|.|..|.:| ...|.|..|:.:|          |
Zfish   248 HLSHMTSLWSLNLRSCDNISDTGIMHLAMGTLRLSGLDVSFCDKIGDQSLAYIA----------Q 302

  Fly   304 NCYTPSHLTISACGVKAWRNVKKTNPRLRVHLRLENLTDGEVVLQPEAPVHSITYCAPQTRIRAE 368
            ..|....|::.:|.:    :....|..:|....|..|..|:.|                 ||..:
Zfish   303 GLYQLKSLSLCSCHI----SDDGINRMVRQMHELRTLNIGQCV-----------------RITDK 346

  Fly   369 LLVRMVDHYKSTLAV--YG 385
            .|..:.||......:  ||
Zfish   347 GLELIADHLTQLTGIDLYG 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11044NP_611456.1 F-box-like 51..94 CDD:289689 12/62 (19%)
fbxl14bNP_001015043.1 F-box-like 5..46 CDD:403981 11/33 (33%)
AMN1 90..296 CDD:187754 45/229 (20%)
leucine-rich repeat 92..118 CDD:275381 3/25 (12%)
leucine-rich repeat 119..144 CDD:275381 5/24 (21%)
leucine-rich repeat 145..170 CDD:275381 4/24 (17%)
leucine-rich repeat 171..203 CDD:275381 8/51 (16%)
leucine-rich repeat 204..229 CDD:275381 10/25 (40%)
AMN1 230..388 CDD:187754 33/170 (19%)
leucine-rich repeat 230..254 CDD:275381 3/26 (12%)
leucine-rich repeat 255..280 CDD:275381 4/24 (17%)
leucine-rich repeat 281..304 CDD:275381 8/32 (25%)
leucine-rich repeat 307..331 CDD:275381 4/27 (15%)
leucine-rich repeat 332..357 CDD:275381 9/41 (22%)
leucine-rich repeat 358..382 CDD:275381 2/8 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.