DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11044 and Fbxl4

DIOPT Version :9

Sequence 1:NP_611456.1 Gene:CG11044 / 37281 FlyBaseID:FBgn0034484 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_572951.1 Gene:Fbxl4 / 32378 FlyBaseID:FBgn0030555 Length:669 Species:Drosophila melanogaster


Alignment Length:507 Identity:89/507 - (17%)
Similarity:154/507 - (30%) Gaps:208/507 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IDGDEKA---CYIDVDEDEDQDTENMIESNWRYLPDLVLEQIFTYLTPKERYYAGLVCRQWYRAF 85
            :||:..|   |..|                   ||..:|.:|.:||..|..:..|.|.|.:|...
  Fly   315 VDGEAAAPQICLTD-------------------LPFEILLRILSYLDLKSLFRVGHVSRTFYDIS 360

  Fly    86 YLPTVWNNFLVDDRTLTKPKFNYYSGWQFCLDHMRTQFCLSRIGRYVRGIEFRPWHSFNNIFQFM 150
            ..|.::....:      ||.::..|....|        .|:|....:|.::......|.|:    
  Fly   361 RHPLLYAEISL------KPYWDVASSELLC--------TLARRATMLRKLDLSWCGGFGNV---- 407

  Fly   151 TMLTWNIDKGREVNPDTQFIGIGSRIRTLVYHFPCNMSQPNDPEGIKLFGT--GGQLLRVLKELL 213
                                                     .|...|.|.|  |..|..      
  Fly   408 -----------------------------------------SPTEFKKFLTQRGDNLTH------ 425

  Fly   214 LRLTDLHTLKLVDFVLERYEANHLLDEVVCSCCTKMRVL--NLVNVTTMHC----PIMHVGLFLN 272
            |||.....|.                   .||...:.::  ||:.::..:|    |:::.....|
  Fly   426 LRLNSCKFLN-------------------ASCIENVGIVCDNLIELSLRNCATEPPLLNFSCLAN 471

  Fly   273 LQVLTISPQNIDD-DVLSLLADTKLRHLHLLQNCYTPSHLTISACGVKAWRNVKKTNPRLRVHLR 336
            |       :|::. |:.....:|:|. |.:|:......||.::.|||.               :.
  Fly   472 L-------KNLERLDLFQTYFETELL-LSMLEGNRKLKHLNLAFCGVS---------------VN 513

  Fly   337 LENLTDGEVVLQPEAPVHSITYCAPQTRIRAELLVRMVDHYKS-TLAVYGHELLPRFSSPKPFHS 400
            ::|:.           .|..||       ..:|:  .:|.:|: .|:..|.:.|.|.       .
  Fly   514 MDNVA-----------AHLATY-------NTQLI--SLDLWKAHFLSSRGLQSLARL-------H 551

  Fly   401 RIDSLMLLMCRQ--------------CFNVDTLIIREKVSTS--TLLLIAKTAKNLQHL------ 443
            :::.|.|..|.:              |..:..|.:.....|:  .|:.||...|||:.|      
  Fly   552 QLEELDLGWCMREASLGDGLFQLLSNCPKLKKLFLSAVRGTTERDLMHIAALGKNLEQLDLMGIL 616

  Fly   444 ---HVRRFAVILRC-----------------DWPRHPEWSNEFYAWLKRNSR 475
               |.|.:.:::.|                 |:....|||.:|...:|.:.|
  Fly   617 NITHERVYDILVNCPKLQLLDLSFCDNIMDRDFDLLAEWSRQFKVDIKSSRR 668

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11044NP_611456.1 F-box-like 51..94 CDD:289689 12/42 (29%)
Fbxl4NP_572951.1 F-box-like 326..372 CDD:289689 13/70 (19%)
leucine-rich repeat 393..422 CDD:275381 8/73 (11%)
leucine-rich repeat 423..442 CDD:275381 7/43 (16%)
LRR_RI 437..>641 CDD:238064 46/253 (18%)
leucine-rich repeat 449..474 CDD:275381 5/31 (16%)
leucine-rich repeat 475..499 CDD:275381 5/24 (21%)
leucine-rich repeat 500..527 CDD:275381 9/59 (15%)
leucine-rich repeat 528..552 CDD:275381 7/32 (22%)
AMN1 552..>660 CDD:187754 20/107 (19%)
leucine-rich repeat 553..580 CDD:275381 4/26 (15%)
leucine-rich repeat 581..606 CDD:275381 5/24 (21%)
leucine-rich repeat 607..632 CDD:275381 5/24 (21%)
leucine-rich repeat 633..652 CDD:275381 1/18 (6%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.