DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11044 and Fbxl21

DIOPT Version :9

Sequence 1:NP_611456.1 Gene:CG11044 / 37281 FlyBaseID:FBgn0034484 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_038951543.1 Gene:Fbxl21 / 306750 RGDID:1305555 Length:460 Species:Rattus norvegicus


Alignment Length:494 Identity:91/494 - (18%)
Similarity:170/494 - (34%) Gaps:159/494 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 NWRYLPDLVLEQIFTYLTPKERYYAGLVCRQWYRAFYLPTVWNNFLVDDRTLTKPKFNYYSGWQF 114
            :|..||..|:.:||.||...:|..|..|||.|...|::|.:|..|                  :|
  Rat    67 DWGTLPHHVILRIFQYLPLVDRARASSVCRSWNEVFHIPDLWRKF------------------EF 113

  Fly   115 CLDHMRTQFCLSRIGRYVRGIEFRPWHSFNNIFQ--------FMTMLTWNIDKGRE--------- 162
            .|:...|.:             |:..|.  ::.|        .:..:::.:|...|         
  Rat   114 ELNQSATSY-------------FKSTHP--DLIQQIIKKHAAHLQYVSFKVDSSTESAEAACHIL 163

  Fly   163 ---VNPDTQFIGIGSRIRTLVYHFPCNMSQPNDPEGIKLFGTGGQLLRVLKELLLRLTDLHTLKL 224
               ||...|.:|:.|..:      |..|:.|.           ...:..|..:.:....|.::|:
  Rat   164 SQLVNCSIQTLGLISTAK------PSFMNMPK-----------SHFVSALTVVFVNSKSLSSIKI 211

  Fly   225 VDFVLERYEANHLLDEVVCSCCTKMRVLNLVNVTTMHCPIMHVG----------------LFLNL 273
            .|..::    :..|..:|.:....:|:|.:.:     ||  ||.                |.||.
  Rat   212 EDTPVD----DPSLKILVANNSDTLRLLKMSS-----CP--HVSSDGILCVADHCQGLRELALNY 265

  Fly   274 QVLTISPQNIDDDVLSLLADT--KLRHLHLLQNCYTPSHLTISACGVKAWRNVKKTNPRLRV--- 333
            .:|:      |:.:|:|.::|  .|.||.:......|..:...:....:|..:.|.:|.:.|   
  Rat   266 YILS------DELLLALSSETHVNLEHLRIDVVSENPGQIKFHSIKKPSWDALVKHSPGVNVVMY 324

  Fly   334 -HLRLENLTDGEVVLQPEAPVHSITYCAPQTR-------IRAELLVRMVDHYKSTLAVYGHELLP 390
             .|..|..   :...:.|.||..:.:....:|       :....|:.:|        |..:.|.|
  Rat   325 FFLYEEEF---DTFFKEETPVTHLYFGRSVSRTILGRIGLNCPRLIELV--------VCANGLQP 378

  Fly   391 RFSSPKPFHSRIDSLMLLMCRQCFNVDTLIIRE-KVSTSTLL-LIAKTAKNLQHLHVRRFAVILR 453
                       :||.::.:...|.|:..|.:.| :||.|..: .:....:.|..|.:....::  
  Rat   379 -----------LDSELIRIAEHCKNLTALGLSECEVSCSAFVEFVRLCGRRLTQLSLMEEVLV-- 430

  Fly   454 CDWPRHPEWSNEFYAWLKRNSRSYEAVEREISQILGYKW 492
                  |:           :..:.:.|..|:|:.||..|
  Rat   431 ------PD-----------DRYTPDEVHTEVSKHLGRVW 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11044NP_611456.1 F-box-like 51..94 CDD:289689 17/42 (40%)
Fbxl21XP_038951543.1 F-box-like 68..111 CDD:403981 17/42 (40%)
leucine-rich repeat 206..231 CDD:275381 5/28 (18%)
leucine-rich repeat 232..257 CDD:275381 6/31 (19%)
leucine-rich repeat 258..283 CDD:275381 8/30 (27%)
leucine-rich repeat 284..318 CDD:275381 6/33 (18%)
leucine-rich repeat 329..365 CDD:275381 5/38 (13%)
AMN1 <359..>424 CDD:187754 16/83 (19%)
leucine-rich repeat 366..392 CDD:275381 8/44 (18%)
leucine-rich repeat 393..418 CDD:275381 5/24 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.