DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11044 and Amn1

DIOPT Version :9

Sequence 1:NP_611456.1 Gene:CG11044 / 37281 FlyBaseID:FBgn0034484 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001008334.2 Gene:Amn1 / 302032 RGDID:1308119 Length:258 Species:Rattus norvegicus


Alignment Length:292 Identity:68/292 - (23%)
Similarity:106/292 - (36%) Gaps:94/292 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 QFCLS----RIGRYVRGIEFRPWHSFNNIFQFMTMLTWNIDKGR-------EV-NPDTQFIGIGS 174
            :.||.    .|.||:..|::.|.:..:.:.:.|:|      :||       || :|:.|.:.:.|
  Rat    12 ELCLRCLIINISRYISDIKYLPPNIKDRLIKIMSM------RGRITDSNINEVLHPEVQRLDLRS 70

  Fly   175 RIRTLVYHFPCNMSQPNDPEGIKLFGTGGQLLRVLKELLLRLTDLHTLKLVDFVLERYEANHLLD 239
                      ||:|.                     ..|..|.....||.::....|...|.:..
  Rat    71 ----------CNISD---------------------VALQHLCKCRKLKALNLKSCREHRNSITS 104

  Fly   240 E---VVCSCCTKMRVLNLVNVTTMHCPIMHVG---LFLNLQVLTI----SPQNIDDDVLSLLADT 294
            |   .|.|.|:.:..::|...    |.:...|   |.||.|:|.|    ...:|.|:.|..|.  
  Rat   105 EGIKAVASSCSDLHEISLKGC----CSVTDEGVLALALNCQLLKIIDLGGCLSITDESLHALG-- 163

  Fly   295 KLRHLHLLQNCYTPSHLTISACGVKAW------RNVKKTNPRLRVHLRLENLTDGEVVLQPEAPV 353
              ::...|| |...|...:|..||.|.      :.:::.|....:     ||||..|    ||  
  Rat   164 --KNCPFLQ-CVDFSTTQVSDNGVVALVSGPCAKQLEEINMGYCI-----NLTDKAV----EA-- 214

  Fly   354 HSITYCAPQTRIRAELLVR----MVDHYKSTL 381
             ::|.| ||..|   ||..    :.||.:..|
  Rat   215 -ALTAC-PQICI---LLFHGCPLITDHSREVL 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11044NP_611456.1 F-box-like 51..94 CDD:289689
Amn1NP_001008334.2 leucine-rich repeat 10..35 CDD:275381 7/22 (32%)
leucine-rich repeat 36..58 CDD:275381 4/27 (15%)
AMN1 37..257 CDD:187754 61/267 (23%)
leucine-rich repeat 63..86 CDD:275381 7/53 (13%)
leucine-rich repeat 87..116 CDD:275381 8/28 (29%)
leucine-rich repeat 117..142 CDD:275381 6/28 (21%)
leucine-rich repeat 143..168 CDD:275381 6/28 (21%)
leucine-rich repeat 169..195 CDD:275381 8/26 (31%)
leucine-rich repeat 196..221 CDD:275381 10/37 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.