DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11044 and Fbxl4

DIOPT Version :9

Sequence 1:NP_611456.1 Gene:CG11044 / 37281 FlyBaseID:FBgn0034484 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_766576.1 Gene:Fbxl4 / 269514 MGIID:2140367 Length:621 Species:Mus musculus


Alignment Length:403 Identity:75/403 - (18%)
Similarity:122/403 - (30%) Gaps:160/403 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 REVNPDTQFIGIGSRIRTLVYHFPCNMSQPNDPEGIKLFGTGGQLLRVLKELLLRLTDLH----- 220
            :::|..|..|.:......|.|:        .:.:.:.|.||..:.|..||..|:.:.||.     
Mouse   196 KQINFPTNLIRLEVNSSLLDYY--------TELDAVVLHGTKDKPLLSLKTALVDMNDLEDDDYE 252

  Fly   221 -------------------------------TLKLVDFVLERYEANHLLDEVVCSCCTKMRVLNL 254
                                           ..:|:..:|     |||....:|......|:|: 
Mouse   253 EKDGCEMDALNKKFSSAALGDGPHNGYFDKLPYELIQLIL-----NHLSLPDLCRLAQTCRLLH- 311

  Fly   255 VNVTTMHC--PIMHVGLFLNLQVLTISPQNIDDDVLSLLADTKLRHLHLLQNCYTPSHLTISACG 317
                 .||  |:.::  .||||           ...:.|.||.|..|.  ..|.....|.:|..|
Mouse   312 -----QHCCDPLQYI--HLNLQ-----------PYWARLDDTSLEFLQ--ARCVLVQWLNLSWTG 356

  Fly   318 VKAWRNVKKTNPRLRV----HLRLE-------NLTDGEVVLQ--PEAPVHSITYC---APQTRIR 366
            .:.:.:|...:..|:|    .:|||       |.|..||:.:  |.....:::.|   .||    
Mouse   357 NRGFISVSGFSRFLKVCGSELVRLELSCSHFLNDTCLEVISEMCPNLQDLNLSSCDKLPPQ---- 417

  Fly   367 AELLVRMVDHYKSTLAVYGHELLPRFSSPKPFHSRIDSLMLLMCRQCFNVDTLIIREKVSTSTLL 431
                            .:||                      :.:.|.....::.|.||..:.||
Mouse   418 ----------------AFGH----------------------IAKLCSLKRLVLYRTKVEQTALL 444

  Fly   432 LIAKTAKNLQHLHVRRFAVILRCDWPRHPEWSNEFYAWLKRNSRSYEAVEREISQILGYKWRLLS 496
            .|......||||.:....:|                       ..|:.    |:.::|.|.:.|.
Mouse   445 SILNFCAELQHLSLGSCVMI-----------------------EDYDV----IASMIGAKCKNLR 482

  Fly   497 DRDF---KQLTVN 506
            ..|.   |.:|.|
Mouse   483 TLDLWRCKNITEN 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11044NP_611456.1 F-box-like 51..94 CDD:289689
Fbxl4NP_766576.1 F-box-like 280..318 CDD:372399 10/48 (21%)
leucine-rich repeat 295..317 CDD:275381 6/27 (22%)
leucine-rich repeat 318..340 CDD:275381 8/34 (24%)
leucine-rich repeat 347..376 CDD:275381 6/28 (21%)
LRR 1 376..397 7/20 (35%)
leucine-rich repeat 377..402 CDD:275381 7/24 (29%)
AMN1 394..601 CDD:187754 29/171 (17%)
LRR 2 402..421 3/38 (8%)
leucine-rich repeat 403..427 CDD:275381 5/65 (8%)
LRR 3 427..448 6/20 (30%)
leucine-rich repeat 428..452 CDD:275381 6/23 (26%)
LRR 4 452..474 7/48 (15%)
leucine-rich repeat 453..480 CDD:275381 9/53 (17%)
LRR 5 480..501 5/16 (31%)
leucine-rich repeat 481..506 CDD:275381 5/15 (33%)
LRR 6 504..524
leucine-rich repeat 507..534 CDD:275381
LRR 7 532..558
leucine-rich repeat 535..560 CDD:275381
LRR 8 559..583
leucine-rich repeat 561..586 CDD:275381
LRR 9 584..609
leucine-rich repeat 587..612 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.