DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11044 and KDM2A

DIOPT Version :9

Sequence 1:NP_611456.1 Gene:CG11044 / 37281 FlyBaseID:FBgn0034484 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_036440.1 Gene:KDM2A / 22992 HGNCID:13606 Length:1162 Species:Homo sapiens


Alignment Length:426 Identity:77/426 - (18%)
Similarity:131/426 - (30%) Gaps:195/426 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GDEKACYIDVDEDEDQDTENMI-----------ESNW------RYLPDLVLEQIFTYLTPKERYY 73
            |||:....:.:|:|:::.|:..           ..:|      .::...|...:|.||:.:|...
Human   848 GDEEGLGGEEEEEEEEEEEDDSAEEGGAARLNGRGSWAQDGDESWMQREVWMSVFRYLSRRELCE 912

  Fly    74 AGLVCRQWYRAFYLPTVWNNFLVDDRTLTKPKFNYYSGWQFCLDHMRTQFCLSRIGRYVRGIEFR 138
            ...||:.||:       |   ..|.|..||            :|..|   |.:.:.:.:.||..|
Human   913 CMRVCKTWYK-------W---CCDKRLWTK------------IDLSR---CKAIVPQALSGIIKR 952

  Fly   139 PWHSFNNIFQFMTMLTW-NIDKGREVNPDTQFIGIGSRIRTLVYHFPCNMSQPNDPEGIKLFGTG 202
            ...|.:        |:| ||.|              .::..||...|                  
Human   953 QPVSLD--------LSWTNISK--------------KQLTWLVNRLP------------------ 977

  Fly   203 GQLLRVLKELLLRLTDLHTLKLVDFVLERYEANHLLDEVVCSCCTKMRVLNLVNVTTMHCPIMH- 266
                 .||:|||                             :.|:...|..|   :|..||::. 
Human   978 -----GLKDLLL-----------------------------AGCSWSAVSAL---STSSCPLLRT 1005

  Fly   267 ------VGL-----------------------FLNLQVLTISPQNIDDDVLSLLADTKLRHLHL- 301
                  ||:                       ..|:....::..:|.|..|.|:    :||:.| 
Human  1006 LDLRWAVGIKDPQIRDLLTPPADKPGQDNRSKLRNMTDFRLAGLDITDATLRLI----IRHMPLL 1066

  Fly   302 ----LQNCYTPSHLT------ISACGVKAWRNV---------KKTNPRLRVHLRLENLTDGEVVL 347
                |.:|   ||||      ::|.|.....::         |.|:..|....|:.|:|      
Human  1067 SRLDLSHC---SHLTDQSSNLLTAVGSSTRYSLTELNMAGCNKLTDQTLIYLRRIANVT------ 1122

  Fly   348 QPEAPVHSITYCAPQTRIRAELLVRMVDHYKSTLAV 383
                 :..:..|...||       :..:|:.|.|::
Human  1123 -----LIDLRGCKQITR-------KACEHFISDLSI 1146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11044NP_611456.1 F-box-like 51..94 CDD:289689 11/48 (23%)
KDM2ANP_036440.1 cupin_like 199..299 CDD:328732
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 367..389
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 532..557
zf-CXXC <576..609 CDD:251032
PHD_KDM2A 619..675 CDD:277113
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 704..789
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 839..887 7/38 (18%)
F-box-like 896..934 CDD:315592 14/59 (24%)
leucine-rich repeat 930..954 CDD:275381 8/38 (21%)
AMN1 932..1138 CDD:332986 54/322 (17%)
leucine-rich repeat 955..978 CDD:275381 9/67 (13%)
LRR 1 961..982 9/57 (16%)
leucine-rich repeat 979..1002 CDD:275381 10/54 (19%)
LRR 2 984..1010 7/57 (12%)
leucine-rich repeat 1003..1040 CDD:275381 2/36 (6%)
leucine-rich repeat 1041..1065 CDD:275381 6/27 (22%)
LRR 3 1048..1073 8/28 (29%)
leucine-rich repeat 1066..1095 CDD:275381 8/31 (26%)
LRR 4 1074..1103 7/31 (23%)
leucine-rich repeat 1096..1120 CDD:275381 4/23 (17%)
LRR 5 1104..1128 6/34 (18%)
leucine-rich repeat 1121..1140 CDD:275381 4/36 (11%)
LRR 6 1129..1156 6/25 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.