DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11044 and B0564.9

DIOPT Version :9

Sequence 1:NP_611456.1 Gene:CG11044 / 37281 FlyBaseID:FBgn0034484 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_502528.2 Gene:B0564.9 / 178266 WormBaseID:WBGene00007208 Length:423 Species:Caenorhabditis elegans


Alignment Length:356 Identity:65/356 - (18%)
Similarity:120/356 - (33%) Gaps:126/356 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LPDLVLEQIFTYLTPKERYYAGLVCRQWYRAFYLPTVWNNFLVDDRTLTKPKFNYYSGWQFCLDH 118
            |||.:.|...|        .:.:.|.:|..|..:...:...|...|     |..|:.....||  
 Worm   127 LPDSIEEISIT--------NSMIECSEWDVATIIRKSFGTLLKKCR-----KLRYFEISGQCL-- 176

  Fly   119 MRTQF-----CLSRIGRYVRGIEFRPWHSFN-NIFQFMTMLTWNIDKG-REVNPDTQFIGIGSRI 176
            |.:.|     .|..|...|..:.....||.. |...|:.      ||. :.:|....||.     
 Worm   177 MNSHFHVDPKILQFISNTVEHLAIAVGHSLTINSLAFLK------DKRLKTLNLQRSFIS----- 230

  Fly   177 RTLVYHFPCNMSQPNDPEGIKLFGTGGQLLRVLKELLLRLTDLHTLKLVDF--VLERYEANHL-- 237
                   ||::..                :..:.:.:..|....::.|:|.  :.|.....||  
 Worm   231 -------PCDLEH----------------IVAMADTITHLDLSRSVNLLDCRQIAELVNLRHLSL 272

  Fly   238 ---------------------LDEVVCSCCTKMRVLNLVNVTTMHCPIMHVGLFLNLQVLTI-SP 280
                                 |:|:...||..:.|.:|:.:..::          ||:.|:: ..
 Worm   273 KNNKEGVRDDSLQLIIKNCSKLEELSLDCCEYLTVNSLITLGNLN----------NLKQLSLPGI 327

  Fly   281 QNIDDDV-LSLLADTKLRHLHL-------------LQNCYTP-SHLTISACGVKAWRNVKKTNPR 330
            .|:||.| |.:...:||.:|::             |.:|.|. .||.:  .|::|:     ::..
 Worm   328 VNVDDSVCLQISRCSKLTYLNINFCRRVQKRGLLCLLSCLTSLDHLEV--LGIRAY-----SHHL 385

  Fly   331 LRVHLR---------LENLTDGEVVLQPEAP 352
            |.:|:.         :|:::   :::.|..|
 Worm   386 LALHINFPKTIVSDYVESIS---IIIPPIPP 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11044NP_611456.1 F-box-like 51..94 CDD:289689 8/39 (21%)
B0564.9NP_502528.2 leucine-rich repeat 106..130 CDD:275381 2/2 (100%)
leucine-rich repeat 131..159 CDD:275381 5/35 (14%)
leucine-rich repeat 166..193 CDD:275381 7/28 (25%)
leucine-rich repeat 195..214 CDD:275381 4/18 (22%)
leucine-rich repeat 219..243 CDD:275381 5/51 (10%)
leucine-rich repeat 244..266 CDD:275381 4/21 (19%)
leucine-rich repeat 267..293 CDD:275381 2/25 (8%)
leucine-rich repeat 294..318 CDD:275381 6/33 (18%)
leucine-rich repeat 319..343 CDD:275381 7/23 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.