DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11044 and B0393.3

DIOPT Version :9

Sequence 1:NP_611456.1 Gene:CG11044 / 37281 FlyBaseID:FBgn0034484 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_497980.1 Gene:B0393.3 / 175630 WormBaseID:WBGene00007168 Length:621 Species:Caenorhabditis elegans


Alignment Length:359 Identity:71/359 - (19%)
Similarity:122/359 - (33%) Gaps:118/359 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 CLSRIGRYVRGIEFRPWHSFNNIFQFMTMLTWNIDKGREVNPDTQFIGIGSRIRTL-VYHFPCNM 187
            |.|:..:.:|.:|.....:.|.             :|        |||:.||:..| ..|  .::
 Worm   180 CFSKAPQTLRKLELECCQTLNK-------------QG--------FIGMCSRLFKLQTLH--VSL 221

  Fly   188 SQPNDPEGIKLFGTGGQLLRVLKEL-----------------LLRLTDLHTLKL--VDFVLERY- 232
            .|..|.:.||..|.    ::.||.|                 :.||:.|.||.|  |:.|.::: 
 Worm   222 MQCIDEQLIKRIGD----MKSLKNLSVVADPDQKMNQFRLAEIRRLSKLTTLCLDGVNNVTDKFL 282

  Fly   233 ---------EANHLLDEVVCSCC--------------TKMRVLNL--VNVTTMHCPIMHVGLFLN 272
                     .|...::.:..|.|              ..::.|||  |:...:...:..:|....
 Worm   283 GDLSDLSTSPAGSSIEHLSLSFCKNIGSNGISKLKTLPNLKSLNLDGVSKRDISTGLEAIGQAGR 347

  Fly   273 LQVLTIS------PQNIDDDV--------LSLLADTKLRHLHLLQNCYTPSHLTISACGV----- 318
            |:.|.:|      |:.|.:.|        |.:..:.:|:.....:..|:....:.....|     
 Worm   348 LERLLVSEDTYVNPKTIAEFVNTCESLRTLDISGNHRLKDKSFAEQVYSARAFSFGKPMVILTDF 412

  Fly   319 -KAWRNVKKTNPRLRVHLRLENLTDGEVVLQPEAPVHSITYCAPQTRIRAELL--VRMVDHYKS- 379
             ..||.:...:.:.||  .:.|:.|    ..||..|.|::....|...|..|:  :|..:.||. 
 Worm   413 KSMWRQLPPFSYQSRV--EIVNIND----RYPEEYVESLSVNTAQQIPRGHLIPDLRRGNRYKML 471

  Fly   380 --TLAVYGHELL--------------PRFSSPKP 397
              .|...|.:|:              |.||.|.|
 Worm   472 DIALNTSGEQLVDPSIFEQHDQENQAPSFSPPGP 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11044NP_611456.1 F-box-like 51..94 CDD:289689
B0393.3NP_497980.1 leucine-rich repeat 103..137 CDD:275381
leucine-rich repeat 138..165 CDD:275381
leucine-rich repeat 188..213 CDD:275381 9/45 (20%)
leucine-rich repeat 214..265 CDD:275381 12/56 (21%)
LRR 232..>389 CDD:227223 28/160 (18%)
AMN1 <262..408 CDD:187754 25/145 (17%)
leucine-rich repeat 266..296 CDD:275381 7/29 (24%)
leucine-rich repeat 297..321 CDD:275381 2/23 (9%)
leucine-rich repeat 348..373 CDD:275381 6/24 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.