DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11044 and fbxl8

DIOPT Version :9

Sequence 1:NP_611456.1 Gene:CG11044 / 37281 FlyBaseID:FBgn0034484 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_012816105.1 Gene:fbxl8 / 100158652 XenbaseID:XB-GENE-1012778 Length:373 Species:Xenopus tropicalis


Alignment Length:459 Identity:90/459 - (19%)
Similarity:174/459 - (37%) Gaps:142/459 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 WRYLPDLVLEQIFTYLTPKERYYAGLVCRQWYRAFYLPTVWNNF---LVDDRTLTKPKFNYYSGW 112
            |:::|..:|..||.:|:..:|:....||:.|..|.....||:..   ||.|:.|           
 Frog     5 WKHMPQEILAIIFYHLSLNDRFVVSQVCQLWAIAMASSPVWHYTEIRLVSDKDL----------- 58

  Fly   113 QFCLDHMRTQFCLSRIGRYVRGIEFRPWHSFNNIFQFMTMLTWNIDKGREVNPDTQFIGIGSRIR 177
                      ..|..:.:||..|:.             ..|.:|  :.:|.|          |::
 Frog    59 ----------LLLEGLRQYVGQIKH-------------LKLVFN--QSKETN----------RMK 88

  Fly   178 TLVYHFPCNMSQPNDPEGIKL--------FGTGGQLLRVLKELLL-RLTDLHTLKLVDFVLERYE 233
             ::..|.|...:....|.:.:        |.:|.::|..:..|.. ...|||.   |||   |..
 Frog    89 -VIEIFDCLCKESCKLESLNIVCCGENPFFYSGPEILTSIANLCRDSPIDLHH---VDF---RNV 146

  Fly   234 ANHLLDEVV-CSCCTKMRVLNL-VNVTTMHCPIMHVGLFLNLQVLTISPQ---------NIDDDV 287
            ...|.|:.| |...:...:.:| :|..|:.|.|....:   .:||.:.|:         ::::||
 Frog   147 PFTLTDDFVRCIATSSPNLRSLYINNGTLVCKISTSAI---KEVLEVCPKLCVLGAFYCSLNEDV 208

  Fly   288 --------------LSLLADTKLRHLHLLQNCYTPSHLTISACGVKAWRNVKKTNPRLRVHLRLE 338
                          |.|..:...:|:           |.||.   :.||:::..:|.|.|::..:
 Frog   209 FKDIMKPHRPPFNCLDLFCERMDKHI-----------LAISD---EVWRDLRCRHPSLHVNMAFD 259

  Fly   339 NLTDGEV---VLQPEAPVHSITYCAPQTRIRAELL--VRMV-DHYKSTLAVYGHELLPRFSSPKP 397
            :......   :|:|..||.::     |.....|::  :|.| .||..||..:   ::...||   
 Frog   260 HTIPARKIPHILKPSIPVDTL-----QLNTFNEMMNEIRFVSSHYSQTLQKF---VIQTTSS--- 313

  Fly   398 FHSRIDSLMLLMCRQCFNVDTL----IIREKVSTSTLLLIAKTAKNLQHLHVRRFAVILRCDWPR 458
              |.:||.::.:..:|..::.:    :::::|..:.|....         |::::.  |:....:
 Frog   314 --SELDSALIDLAGKCSRLEEVHCYCVVKQEVIQAFLTCCP---------HLKKYT--LKVIKEK 365

  Fly   459 HPEW 462
            || |
 Frog   366 HP-W 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11044NP_611456.1 F-box-like 51..94 CDD:289689 13/42 (31%)
fbxl8XP_012816105.1 F-box 5..47 CDD:395521 13/41 (32%)
leucine-rich repeat 103..133 CDD:275381 5/29 (17%)
leucine-rich repeat 138..164 CDD:275381 10/31 (32%)
leucine-rich repeat 165..193 CDD:275381 7/30 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1216869at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.