DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JUP and Uck

DIOPT Version :10

Sequence 1:XP_047291890.1 Gene:JUP / 3728 HGNCID:6207 Length:762 Species:Homo sapiens
Sequence 2:NP_001138105.1 Gene:Uck / 42894 FlyBaseID:FBgn0263398 Length:305 Species:Drosophila melanogaster


Alignment Length:199 Identity:36/199 - (18%)
Similarity:66/199 - (33%) Gaps:69/199 - (34%)


- Green bases have known domain annotations that are detailed below.


Human   537 EAAVIPRLVQLLVKAHQD-AQRHVAAGTQQPYTDGVRMEEIVEGCTGALHILARDPMNRMEIFRL 600
            ::.|..::::.|.:|..| .||.|.:.:|..:...:...|..:...|..:....|..|.      
  Fly    40 KSTVCKKIMEQLGQAEMDHTQRQVVSISQDSFYRELTPAEKAKAQKGLFNFDHPDAFNE------ 98

Human   601 NTIPLFVQLLYSSVENIQRVAAGVLCELAQDKEAADAIDAEGASA------------------PL 647
                   :|:||:::||.:   |...|:.......:::|.|....                  .:
  Fly    99 -------ELMYSTLQNILK---GHKVEIPSYDYRTNSLDFENVLVIYPADVVLFEGILVFYFPKI 153

Human   648 MELLHSRNEGTATYAAAVLFRISEDKNPDYRKRVSVELTNSLFKHDPAAWEAAQSMIPINEPYGD 712
            .||.|.:           || :..|.:....:||..:                     ||| .|.
  Fly   154 RELFHMK-----------LF-VDTDSDTRLARRVPRD---------------------INE-RGR 184

Human   713 DMDA 716
            |:||
  Fly   185 DLDA 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JUPXP_047291890.1 CTNNAbd_CTNNG 90..159 CDD:439242
armadillo repeat 161..186 CDD:293788
armadillo repeat 203..229 CDD:293788
armadillo repeat 238..270 CDD:293788
Arm 238..270 CDD:425727
armadillo repeat 278..314 CDD:293788
armadillo repeat 322..355 CDD:293788
PLN03200 <345..>675 CDD:215629 27/156 (17%)
ARM 358..398 CDD:214547
armadillo repeat 362..397 CDD:293788
armadillo repeat 410..435 CDD:293788
armadillo repeat 443..481 CDD:293788
armadillo repeat 487..525 CDD:293788
armadillo repeat 532..589 CDD:293788 10/52 (19%)
armadillo repeat 594..628 CDD:293788 6/33 (18%)
armadillo repeat 635..669 CDD:293788 7/51 (14%)
UckNP_001138105.1 UMPK 29..235 CDD:238981 36/199 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.