DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JUP and p120ctn

DIOPT Version :9

Sequence 1:XP_016880077.1 Gene:JUP / 3728 HGNCID:6207 Length:762 Species:Homo sapiens
Sequence 2:NP_001036444.1 Gene:p120ctn / 3355143 FlyBaseID:FBgn0260799 Length:781 Species:Drosophila melanogaster


Alignment Length:533 Identity:107/533 - (20%)
Similarity:179/533 - (33%) Gaps:194/533 - (36%)


- Green bases have known domain annotations that are detailed below.


Human   240 FKSGGIPALVRMLSSPVESVLFYAITTLHNLLLYQEGAKMAVRLADGLQKMVPLLNKNNPKFLAI 304
            ::...:..::..||:|..::...|...|.:|....:..|...|...|:..:|.||:.::|:....
  Fly   222 WRDPNLSEVISFLSNPSSAIKANAAAYLQHLCYMDDPNKQRTRSLGGIPPLVRLLSYDSPEIHKN 286

Human   305 TTDCLQLLAYGNQESKLIILANGGPQALVQIMRNYSYEKLLWTTSRVLKVLSVCPSNKPAIVEAG 369
            ....|:.|:||.|..:                                        ||..|..||
  Fly   287 ACGALRNLSYGRQNDE----------------------------------------NKRGIKNAG 311

Human   370 GMQALGKHLTSNS-----PRLVQNCLWTLRNLSDVATK--QEGLESVLKILVNQLSVDDV----- 422
            |:.|| .||...|     ..||...||.:.:..|:...  .|.|.:|:..::...|..|.     
  Fly   312 GIAAL-VHLLCRSQETEVKELVTGVLWNMSSCEDLKRSIIDEALVAVVCSVIKPHSGWDAVCCGE 375

Human   423 ----NVLTCATGTLSNL-TCNNSKNKTLVTQNSGVEALIHAILRAGDKDDI----TEPAVCALRH 478
                .|...|:|.|.|: :........|......||.|::.:..:.:|::|    .|..||.||:
  Fly   376 TCFSTVFRNASGVLRNVSSAGEHARGCLRNCEHLVECLLYVVRTSIEKNNIGNKTVENCVCILRN 440

Human   479 LTSR-----------HP----------------------------------------EAEMAQNS 492
            |:.|           ||                                        .|:.:::|
  Fly   441 LSYRCQEVDDPNYDKHPFITPERVIPSSSKGENLGCFGTNKKKKEANNSDALNEYNISADYSKSS 505

Human   493 V---RLNYGI-----PAIVK----LLNQPNQWPLVKATIGLIRNLALC---PA--NHAPLQEAAV 540
            |   :||.|.     |.:|:    ||...:....::|..|.|:||:.|   |:  ..|.:::...
  Fly   506 VTYNKLNKGYEQLWQPEVVQYYLSLLQSCSNPETLEAAAGAIQNLSACYWQPSIDIRATVRKEKG 570

Human   541 IPRLVQLLVKAHQDAQRHVAAGTQQPYTDGVRME--EIVEGCTGALHILARDPMNRMEIFRLNTI 603
            :|.||:||                       |||  .:|.....||..||.|..|:..|.:    
  Fly   571 LPILVELL-----------------------RMEVDRVVCAVATALRNLAIDQRNKELIGK---- 608

Human   604 PLFVQLLYSSVENIQRVAAGVLCELAQDKEAADAIDAEGASAPLMELLHSRNEGTATYAAAVLFR 668
                   |:..:.:|::.:|                         .:.|.:|....| ..|||..
  Fly   609 -------YAMRDLVQKLPSG-------------------------NVQHDQNTSDDT-ITAVLAT 640

Human   669 ISE--DKNPDYRK 679
            |:|  .|||::.:
  Fly   641 INEVIKKNPEFSR 653

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JUPXP_016880077.1 armadillo repeat 161..186 CDD:293788
armadillo repeat 203..229 CDD:293788
armadillo repeat 238..270 CDD:293788 5/29 (17%)
ARM 238..270 CDD:214547 5/29 (17%)
armadillo repeat 278..314 CDD:293788 9/35 (26%)
armadillo repeat 322..355 CDD:293788 0/32 (0%)
PLN03200 <345..>675 CDD:215629 87/422 (21%)
ARM 358..398 CDD:214547 15/44 (34%)
armadillo repeat 362..397 CDD:293788 14/39 (36%)
armadillo repeat 410..435 CDD:293788 6/33 (18%)
armadillo repeat 443..481 CDD:293788 12/41 (29%)
armadillo repeat 487..525 CDD:293788 12/49 (24%)
armadillo repeat 532..589 CDD:293788 13/58 (22%)
armadillo repeat 594..628 CDD:293788 4/33 (12%)
armadillo repeat 635..669 CDD:293788 6/33 (18%)
p120ctnNP_001036444.1 ARM 227..341 CDD:237987 33/154 (21%)
armadillo repeat 227..252 CDD:293788 5/24 (21%)
armadillo repeat 260..296 CDD:293788 9/35 (26%)
armadillo repeat 304..339 CDD:293788 14/35 (40%)
ARM 307..442 CDD:237987 35/135 (26%)
armadillo repeat 347..392 CDD:293788 9/44 (20%)
armadillo repeat 515..556 CDD:293788 10/40 (25%)
ARM 516..643 CDD:237987 38/186 (20%)
armadillo repeat 562..596 CDD:293788 12/56 (21%)
armadillo repeat 601..641 CDD:293788 11/76 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2332
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.