DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 18w and AT1G72940

DIOPT Version :10

Sequence 1:NP_476814.1 Gene:18w / 37277 FlyBaseID:FBgn0287775 Length:1385 Species:Drosophila melanogaster
Sequence 2:NP_177437.1 Gene:AT1G72940 / 843625 AraportID:AT1G72940 Length:371 Species:Arabidopsis thaliana


Alignment Length:176 Identity:41/176 - (23%)
Similarity:72/176 - (40%) Gaps:53/176 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   825 ASNLM---TLQNGSLAQLVNLRVLHLE--NNKLTALEGTEFRSLGLLRE---------LYLHNNM 875
            :.|||   |:.||.  .||.:.. |::  |.||........|.:|:...         .|::.::
plant   170 SKNLMTVTTISNGK--NLVGIDT-HMKALNKKLDLNSNKSLRVVGIWARGYNGRSALAKYVYQDI 231

  Fly   876 LTHISNATFEPLVSLEVLRLDNNRLSSLPHLQYRHS-----LQG----------LTLGRNAWSCR 925
            ..|..:..|  |.|::       |:|...||.:.|.     :||          |.:..:.:  :
plant   232 CHHFDSHCF--LGSVK-------RISQGRHLSHLHEEFLIRIQGSKHNLKDQKVLLVADDVY--K 285

  Fly   926 CQQLRELAQ----FVSDNAMVV--RDAHDIYCLDAGIK--RELELI 963
            .:||..||:    |...:.:::  :|.|  ..:.||||  .|:||:
plant   286 LEQLDALAEDFNGFGPGSVVIITTQDKH--LFVSAGIKLVYEVELL 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
18wNP_476814.1 leucine-rich repeat 66..91 CDD:275380
leucine-rich repeat 92..115 CDD:275380
LRR_8 115..181 CDD:404697
leucine-rich repeat 116..146 CDD:275380
leucine-rich repeat 147..170 CDD:275380
leucine-rich repeat 171..201 CDD:275380
LRR 210..592 CDD:443914
leucine-rich repeat 212..236 CDD:275380
leucine-rich repeat 237..260 CDD:275380
leucine-rich repeat 261..284 CDD:275380
leucine-rich repeat 285..308 CDD:275380
leucine-rich repeat 309..334 CDD:275380
leucine-rich repeat 335..358 CDD:275380
leucine-rich repeat 359..382 CDD:275380
leucine-rich repeat 383..406 CDD:275380
leucine-rich repeat 407..430 CDD:275380
leucine-rich repeat 431..451 CDD:275380
leucine-rich repeat 454..477 CDD:275380
leucine-rich repeat 478..499 CDD:275380
leucine-rich repeat 502..525 CDD:275380
leucine-rich repeat 526..548 CDD:275380
leucine-rich repeat 590..617 CDD:275380
leucine-rich repeat 618..641 CDD:275380
leucine-rich repeat 642..689 CDD:275380
LRRCT 679..736 CDD:214507
LRR <775..>920 CDD:443914 27/123 (22%)
leucine-rich repeat 775..796 CDD:275380
leucine-rich repeat 797..817 CDD:275380
leucine-rich repeat 818..841 CDD:275380 7/18 (39%)
leucine-rich repeat 842..865 CDD:275380 5/24 (21%)
leucine-rich repeat 866..889 CDD:275380 4/31 (13%)
leucine-rich repeat 890..911 CDD:275380 4/20 (20%)
TIR 1045..1183 CDD:214587
AT1G72940NP_177437.1 PLN03210 9..>345 CDD:215633 41/176 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.