DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 18w and AT1G72890

DIOPT Version :10

Sequence 1:NP_476814.1 Gene:18w / 37277 FlyBaseID:FBgn0287775 Length:1385 Species:Drosophila melanogaster
Sequence 2:NP_001185387.1 Gene:AT1G72890 / 843620 AraportID:AT1G72890 Length:487 Species:Arabidopsis thaliana


Alignment Length:104 Identity:27/104 - (25%)
Similarity:42/104 - (40%) Gaps:26/104 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1044 LYDAII---LHSEKDYEFVCRNIAAELEHGRPPFRLCIQQRDLPPQASHLQLVEGARASRKIILV 1105
            ||.|::   :.:.||.|        |||.|||          :||     :|.:..:.||..::|
plant    58 LYKALVSKGIRTFKDDE--------ELERGRP----------IPP-----ELRQAIKGSRIAVVV 99

  Fly  1106 LTRNLLATEWNRIEFRNAFHESLRGLAQKLVIIEETSVS 1144
            ::....|:.|...|.|........||...:.|..|.:.|
plant   100 VSVTYPASSWCLEELREILKLEKLGLLTVIPIFYEINPS 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
18wNP_476814.1 leucine-rich repeat 66..91 CDD:275380
leucine-rich repeat 92..115 CDD:275380
LRR_8 115..181 CDD:404697
leucine-rich repeat 116..146 CDD:275380
leucine-rich repeat 147..170 CDD:275380
leucine-rich repeat 171..201 CDD:275380
LRR 210..592 CDD:443914
leucine-rich repeat 212..236 CDD:275380
leucine-rich repeat 237..260 CDD:275380
leucine-rich repeat 261..284 CDD:275380
leucine-rich repeat 285..308 CDD:275380
leucine-rich repeat 309..334 CDD:275380
leucine-rich repeat 335..358 CDD:275380
leucine-rich repeat 359..382 CDD:275380
leucine-rich repeat 383..406 CDD:275380
leucine-rich repeat 407..430 CDD:275380
leucine-rich repeat 431..451 CDD:275380
leucine-rich repeat 454..477 CDD:275380
leucine-rich repeat 478..499 CDD:275380
leucine-rich repeat 502..525 CDD:275380
leucine-rich repeat 526..548 CDD:275380
leucine-rich repeat 590..617 CDD:275380
leucine-rich repeat 618..641 CDD:275380
leucine-rich repeat 642..689 CDD:275380
LRRCT 679..736 CDD:214507
LRR <775..>920 CDD:443914
leucine-rich repeat 775..796 CDD:275380
leucine-rich repeat 797..817 CDD:275380
leucine-rich repeat 818..841 CDD:275380
leucine-rich repeat 842..865 CDD:275380
leucine-rich repeat 866..889 CDD:275380
leucine-rich repeat 890..911 CDD:275380
TIR 1045..1183 CDD:214587 26/103 (25%)
AT1G72890NP_001185387.1 PLN03210 39..>413 CDD:215633 27/104 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.