DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 18w and RLP12

DIOPT Version :9

Sequence 1:NP_476814.1 Gene:18w / 37277 FlyBaseID:FBgn0004364 Length:1385 Species:Drosophila melanogaster
Sequence 2:NP_177296.2 Gene:RLP12 / 843481 AraportID:AT1G71400 Length:847 Species:Arabidopsis thaliana


Alignment Length:766 Identity:177/766 - (23%)
Similarity:305/766 - (39%) Gaps:151/766 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 GVWCSMPSLQLLNL------TQNRIRSAEFLGFSEKLCAGSALSNAN------GAVSGGSELQTL 215
            ||.|:..|.|:::|      ..|.:::...| |..:......|:|.|      .::...|.|..:
plant    76 GVTCNDKSGQVISLDIPNTFLNNYLKTNSSL-FKLQYLRHLDLTNCNLYGEIPSSLGNLSHLTLV 139

  Fly   216 DVSFNE-LRSLPDAWGASRLRRLQTLSLQHNNISTLAPNALAGLSSLRVLNISYNHLVSLPSEAF 279
            ::.||: :..:|.:.|  .|.:|:.|.|.:|.::...|::|..||.|..|.:..|.||....::.
plant   140 NLYFNKFVGEIPASIG--NLNQLRHLILANNVLTGEIPSSLGNLSRLVNLELFSNRLVGKIPDSI 202

  Fly   280 AGNKELRELHLQGNDLY-ELPKGLLHRLEQLLVLDLSGNQLTSHHVDNSTFAGLIRLIVLNLSNN 343
            ...|:||.|.|..|:|. |:|.. |..|..|:.|.|:.|||...  ..::...||.|.|::..||
plant   203 GDLKQLRNLSLASNNLIGEIPSS-LGNLSNLVHLVLTHNQLVGE--VPASIGNLIELRVMSFENN 264

  Fly   344 ALTRIGSKTFKELYFLQILDMRNNSIGHIEEGAFLPLYNLHTLNLAENRLHTLDNRIFNGLYVLT 408
            :|:.....:|..|..|.|..:.:|:............:||...:::.|.        |:|.:. .
plant   265 SLSGNIPISFANLTKLSIFVLSSNNFTSTFPFDMSIFHNLEYFDVSYNS--------FSGPFP-K 320

  Fly   409 KLTLNNNLVSIV--ESQ-----AFRNCSD---LKELDLSSNQL-TEVPEAVQDLSMLKTLDLGEN 462
            .|.|..:|.||.  |:|     .|.|.|.   |::|.|..|:| ..:||::..|..|:.||:..|
plant   321 SLLLIPSLESIYLQENQFTGPIEFANTSSSTKLQDLILGRNRLHGPIPESISRLLNLEELDISHN 385

  Fly   463 QISEFKNNTFRNLNQLTGLRLIDNRI-GNITVGMFQDLPRLSVLNLAKNRIQSIERGAFDKNTEI 526
            ..:.....|...|..|..|.|..|.: |.:...::    ||:.:.|:.|...|.|..: .:...|
plant   386 NFTGAIPPTISKLVNLLHLDLSKNNLEGEVPACLW----RLNTMVLSHNSFSSFENTS-QEEALI 445

  Fly   527 EAIRLDKN-FLTDINGIFATLASLLWLNLSENHLVWFDYAFIPS-------NLKWLDI-HGNYIE 582
            |.:.|:.| |...|..:...|:||.:|:||.|    .....|||       ::|.|:: ..|:..
plant   446 EELDLNSNSFQGPIPYMICKLSSLGFLDLSNN----LFSGSIPSCIRNFSGSIKELNLGDNNFSG 506

  Fly   583 ALGNYYKLQEEIRVTTLDASHNRITEIGAMSVPN--SIELLFINNNIIGQIQANTFVDKTRLARV 645
            .|.:.:....|:  .:||.|||::......|:.|  ::||:.:.:|.|..|..:.......|..:
plant   507 TLPDIFSKATEL--VSLDVSHNQLEGKFPKSLINCKALELVNVESNKIKDIFPSWLESLPSLHVL 569

  Fly   646 DLYANVL--------SKISLNALRVAPVSAEK---PVPEFYLGGNPFECDCSMEWLQRINNLTTR 699
            :|.:|..        :.|...:||:..:|...   .:|.:|..          .| :.:..||..
plant   570 NLRSNKFYGPLYHRHASIGFQSLRIIDISHNNFSGTLPPYYFS----------NW-KDMTTLTEE 623

  Fly   700 QHPHVVDLGNIECLMPHSRSAPLRPLASLSASDFVCKYESHCPPTCHCCEYEQCECEVICPGNCS 764
            ...::.:.                           .:|..                        |
plant   624 MDQYMTEF---------------------------WRYAD------------------------S 637

  Fly   765 CFHDATWATNIVDCGRQDLAALPNRIPQDVSDLYLDGN----NMPELEVGHLTGRRNLRALYLNA 825
            .:|:.......||...:       ||.:|...:...||    |:|| .:|:|   :.||.|.|:.
plant   638 YYHEMEMVNKGVDMSFE-------RIRRDFRAIDFSGNKINGNIPE-SLGYL---KELRVLNLSG 691

  Fly   826 SNLMTLQNGSLAQLVNLRVLHLENNKLTALEGTEFRSLGLLRELYLHNNML 876
            :...::....||.|..|..|.:..|||:.....:..:|..|..:...:|:|
plant   692 NAFTSVIPRFLANLTKLETLDISRNKLSGQIPQDLAALSFLSYMNFSHNLL 742

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
18wNP_476814.1 leucine-rich repeat 66..91 CDD:275380
leucine-rich repeat 92..115 CDD:275380
LRR_8 115..181 CDD:290566 7/23 (30%)
leucine-rich repeat 116..146 CDD:275380
leucine-rich repeat 147..170 CDD:275380 3/6 (50%)
leucine-rich repeat 171..201 CDD:275380 6/35 (17%)
LRR_RI 210..464 CDD:238064 76/266 (29%)
leucine-rich repeat 212..236 CDD:275380 6/24 (25%)
LRR_8 235..295 CDD:290566 19/59 (32%)
leucine-rich repeat 237..260 CDD:275380 7/22 (32%)
leucine-rich repeat 261..284 CDD:275380 5/22 (23%)
LRR_8 283..345 CDD:290566 23/62 (37%)
leucine-rich repeat 285..308 CDD:275380 10/23 (43%)
leucine-rich repeat 309..334 CDD:275380 7/24 (29%)
LRR_8 334..393 CDD:290566 13/58 (22%)
leucine-rich repeat 335..358 CDD:275380 7/22 (32%)
leucine-rich repeat 359..382 CDD:275380 3/22 (14%)
LRR_8 382..441 CDD:290566 19/68 (28%)
leucine-rich repeat 383..406 CDD:275380 4/22 (18%)
leucine-rich repeat 407..430 CDD:275380 9/29 (31%)
LRR_8 431..488 CDD:290566 18/57 (32%)
leucine-rich repeat 431..451 CDD:275380 7/20 (35%)
leucine-rich repeat 454..477 CDD:275380 6/22 (27%)
LRR_8 477..559 CDD:290566 24/83 (29%)
leucine-rich repeat 478..499 CDD:275380 5/21 (24%)
leucine-rich repeat 502..525 CDD:275380 5/22 (23%)
leucine-rich repeat 526..548 CDD:275380 7/22 (32%)
leucine-rich repeat 590..617 CDD:275380 8/28 (29%)
leucine-rich repeat 618..641 CDD:275380 5/22 (23%)
leucine-rich repeat 642..689 CDD:275380 9/57 (16%)
LRRCT 679..736 CDD:214507 3/56 (5%)
leucine-rich repeat 775..796 CDD:275380 5/20 (25%)
LRR_8 797..852 CDD:290566 17/58 (29%)
leucine-rich repeat 797..817 CDD:275380 7/23 (30%)
leucine-rich repeat 818..841 CDD:275380 7/22 (32%)
LRR_8 841..900 CDD:290566 9/36 (25%)
leucine-rich repeat 842..865 CDD:275380 6/22 (27%)
LRR_4 866..907 CDD:289563 3/11 (27%)
leucine-rich repeat 866..889 CDD:275380 3/11 (27%)
leucine-rich repeat 890..911 CDD:275380
TIR 1045..1183 CDD:214587
RLP12NP_177296.2 LRRNT_2 36..80 CDD:285463 2/3 (67%)
LRR_8 112..170 CDD:290566 14/59 (24%)
leucine-rich repeat 112..135 CDD:275380 3/22 (14%)
leucine-rich repeat 136..159 CDD:275380 6/24 (25%)
LRR_8 159..218 CDD:290566 19/58 (33%)
leucine-rich repeat 160..183 CDD:275380 7/22 (32%)
leucine-rich repeat 184..207 CDD:275380 5/22 (23%)
LRR_RI 198..479 CDD:238064 82/301 (27%)
LRR_8 206..266 CDD:290566 23/62 (37%)
leucine-rich repeat 208..231 CDD:275380 10/23 (43%)
leucine-rich repeat 232..255 CDD:275380 7/24 (29%)
leucine-rich repeat 256..279 CDD:275380 7/22 (32%)
leucine-rich repeat 280..352 CDD:275380 18/80 (23%)
leucine-rich repeat 304..322 CDD:275380 4/26 (15%)
LRR_8 351..411 CDD:290566 18/59 (31%)
leucine-rich repeat 353..376 CDD:275380 8/22 (36%)
LRR_RI 374..601 CDD:238064 58/237 (24%)
leucine-rich repeat 377..400 CDD:275380 6/22 (27%)
leucine-rich repeat 401..422 CDD:275380 5/24 (21%)
leucine-rich repeat 445..468 CDD:275380 7/22 (32%)
leucine-rich repeat 469..493 CDD:275380 8/27 (30%)
leucine-rich repeat 494..517 CDD:275380 4/22 (18%)
LRR_8 516..576 CDD:290566 16/61 (26%)
leucine-rich repeat 518..541 CDD:275380 7/24 (29%)
leucine-rich repeat 542..565 CDD:275380 5/22 (23%)
leucine-rich repeat 592..616 CDD:275380 6/34 (18%)
leucine-rich repeat 617..683 CDD:275380 17/127 (13%)
LRR_8 682..742 CDD:290566 15/59 (25%)
LRR_4 682..719 CDD:289563 11/36 (31%)
leucine-rich repeat 684..707 CDD:275380 7/22 (32%)
leucine-rich repeat 708..729 CDD:275380 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.