DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 18w and AT1G65850

DIOPT Version :10

Sequence 1:NP_476814.1 Gene:18w / 37277 FlyBaseID:FBgn0287775 Length:1385 Species:Drosophila melanogaster
Sequence 2:NP_001185325.1 Gene:AT1G65850 / 842896 AraportID:AT1G65850 Length:1051 Species:Arabidopsis thaliana


Alignment Length:451 Identity:92/451 - (20%)
Similarity:167/451 - (37%) Gaps:129/451 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 HASELAPGLFRQLQKLSELRIDACKLQRVPPNAFEGLMSLKRLTLESHNAVWGPGKTLELHGQSF 141
            |.:|.:..:.:.|..|:|                :.|:|::...::.||.:...||.:..||...
plant   493 HLAEKSLNVKQGLHVLTE----------------KSLISIEGGRIKMHNLLEQLGKEIVRHGLGH 541

  Fly   142 QGLKE------------LSELHLGDNNIR----------------QLPEGVWCSMPSLQLLNL-- 176
            |.::|            :.||...|...:                .:.|..:..||:|:.|..  
plant   542 QPIREPGKRQFLVDTRDICELLTNDTGSKSVIGIHFYSSELSSELNISERAFEGMPNLKFLRFYY 606

  Fly   177 ----TQNRIRSAEFLGF-SEKL-----------CAGSALSNANGAVSGGSELQTLDVSFNELRSL 225
                ..:::...:.|.: |:||           |..|....        ..|..|::.|::|..|
plant   607 RYGDESDKLYLPQGLNYLSQKLKILEWDHFPLTCMPSNFCT--------EYLVELNMRFSKLHKL 663

  Fly   226 PDAWGASR-LRRLQTLSLQHNNISTLAPNALAGLSSLRVLNISYNHLVSLPSEAFAGNKELRELH 289
               |..:| |..|..:.|.|:.|....|:.....:...:..:..:.||.||| :......|::|:
plant   664 ---WEGNRPLANLNWMYLNHSKILKELPDLSTATNLQELFLVKCSSLVELPS-SIGKATNLQKLY 724

  Fly   290 L-QGNDLYELPK--GLLHRLEQLLVLDLSGNQLTSHHVDNSTFAGLIRLIVL--NLSNNALTRIG 349
            | ....|.|||.  |.||:|::|                  |..|..:|.||  |::..:|..:.
plant   725 LNMCTSLVELPSSIGNLHKLQKL------------------TLNGCSKLEVLPANINLESLDELD 771

  Fly   350 ------SKTFKELYF-LQILDMRNNSIGHIEEGAFLPLYNLHTLNLAENR-----LHTLDNRIFN 402
                  .|.|.|:.. :::|.:...:|..: ..:......|..|.|:.|:     :|.||     
plant   772 LTDCLVLKRFPEISTNIKVLKLLRTTIKEV-PSSIKSWPRLRDLELSYNQNLKGFMHALD----- 830

  Fly   403 GLYVLTKLTLNNNLVSIVESQAF----RNCSDLKELDLSS-NQLTEVPEAVQDLSMLKTLD 458
               ::|.:..|:     :|.|..    :..|.|:.|.|:. .:|..:|:....||.||.::
plant   831 ---IITTMYFND-----IEMQEIPLWVKKISRLQTLILNGCKKLVSLPQLPDSLSYLKVVN 883

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
18wNP_476814.1 leucine-rich repeat 66..91 CDD:275380 3/13 (23%)
leucine-rich repeat 92..115 CDD:275380 3/22 (14%)
LRR_8 115..181 CDD:404697 17/99 (17%)
leucine-rich repeat 116..146 CDD:275380 7/29 (24%)
leucine-rich repeat 147..170 CDD:275380 5/38 (13%)
leucine-rich repeat 171..201 CDD:275380 8/47 (17%)
LRR 210..592 CDD:443914 63/272 (23%)
leucine-rich repeat 212..236 CDD:275380 8/24 (33%)
leucine-rich repeat 237..260 CDD:275380 5/22 (23%)
leucine-rich repeat 261..284 CDD:275380 5/22 (23%)
leucine-rich repeat 285..308 CDD:275380 11/25 (44%)
leucine-rich repeat 309..334 CDD:275380 3/24 (13%)
leucine-rich repeat 335..358 CDD:275380 8/30 (27%)
leucine-rich repeat 359..382 CDD:275380 2/22 (9%)
leucine-rich repeat 383..406 CDD:275380 7/27 (26%)
leucine-rich repeat 407..430 CDD:275380 4/26 (15%)
leucine-rich repeat 431..451 CDD:275380 5/20 (25%)
leucine-rich repeat 454..477 CDD:275380 2/5 (40%)
leucine-rich repeat 478..499 CDD:275380
leucine-rich repeat 502..525 CDD:275380
leucine-rich repeat 526..548 CDD:275380
leucine-rich repeat 590..617 CDD:275380
leucine-rich repeat 618..641 CDD:275380
leucine-rich repeat 642..689 CDD:275380
LRRCT 679..736 CDD:214507
LRR <775..>920 CDD:443914
leucine-rich repeat 775..796 CDD:275380
leucine-rich repeat 797..817 CDD:275380
leucine-rich repeat 818..841 CDD:275380
leucine-rich repeat 842..865 CDD:275380
leucine-rich repeat 866..889 CDD:275380
leucine-rich repeat 890..911 CDD:275380
TIR 1045..1183 CDD:214587
AT1G65850NP_001185325.1 PLN03210 46..1048 CDD:215633 92/451 (20%)
leucine-rich repeat 599..627 CDD:275380 4/27 (15%)
leucine-rich repeat 628..649 CDD:275380 3/28 (11%)
leucine-rich repeat 650..669 CDD:275380 6/21 (29%)
leucine-rich repeat 673..695 CDD:275380 5/21 (24%)
leucine-rich repeat 696..719 CDD:275380 5/23 (22%)
leucine-rich repeat 720..743 CDD:275380 9/22 (41%)
leucine-rich repeat 744..766 CDD:275380 8/39 (21%)
leucine-rich repeat 767..810 CDD:275380 6/43 (14%)
leucine-rich repeat 811..854 CDD:275380 11/55 (20%)
leucine-rich repeat 855..886 CDD:275380 9/29 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.