DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 18w and RPP27

DIOPT Version :10

Sequence 1:NP_476814.1 Gene:18w / 37277 FlyBaseID:FBgn0287775 Length:1385 Species:Drosophila melanogaster
Sequence 2:NP_175849.2 Gene:RPP27 / 841889 AraportID:AT1G54470 Length:457 Species:Arabidopsis thaliana


Alignment Length:297 Identity:92/297 - (30%)
Similarity:124/297 - (41%) Gaps:80/297 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 ASRLRRLQTLSLQHNNISTLAPNALAGLSSLRVLNISYNHLVSLPSEAFAGNKELRELHLQG--N 293
            :.||.||      |...|.|..|:|        ||||..|    |.|      |:|.|.|..  |
plant   177 SGRLIRL------HVGASNLKENSL--------LNISLLH----PFE------EVRSLELSAGLN 217

  Fly   294 DLYELPKGL--LHRLEQLLVLDLSGNQLTSHHVDNSTFAGLIRLIVLNLSNNALTRIGSKTFKEL 356
            ...:..:|.  |.:|:.|.:||||.|.                    ..:||.|..|.:.|    
plant   218 GFVDNVEGYKSLRKLKNLEILDLSYNN--------------------RFNNNILPFINAAT---- 258

  Fly   357 YFLQILDMRNNSIGHIEEGAF-----LPLYNLHTLNLAENRLHTLDNRIFNGLYVLTK---LTLN 413
             .|..|.::|||:    ||.|     ..|.||..|:|:.|.|    .....||..|.|   |.|:
plant   259 -SLTSLSLQNNSM----EGPFPFEEIKDLTNLKLLDLSRNIL----KGPMQGLTHLKKLKALDLS 314

  Fly   414 NNLV-SIVESQAFRNCSDLKELDLSSNQLT-EVPEAVQDLSMLKTLDLGENQISEFKNNTFRNLN 476
            ||:. ||:|.|......:|.||||..|:.. ::|..:..|:.|:.|||..||::....:||..|.
plant   315 NNVFSSIMELQVVCEMKNLWELDLRENKFVGQLPLCLGRLNKLRVLDLSSNQLNGNLPSTFNRLE 379

  Fly   477 QLTGLRLIDNRIGNITVGMFQ-----DLPRLSVLNLA 508
            .|..|.|:||   |.| |.|.     :|.:|.|..|:
plant   380 SLEYLSLLDN---NFT-GFFSFDPLANLTKLKVFKLS 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
18wNP_476814.1 leucine-rich repeat 66..91 CDD:275380
leucine-rich repeat 92..115 CDD:275380
LRR_8 115..181 CDD:404697
leucine-rich repeat 116..146 CDD:275380
leucine-rich repeat 147..170 CDD:275380
leucine-rich repeat 171..201 CDD:275380
LRR 210..592 CDD:443914 92/297 (31%)
leucine-rich repeat 212..236 CDD:275380 2/4 (50%)
leucine-rich repeat 237..260 CDD:275380 6/22 (27%)
leucine-rich repeat 261..284 CDD:275380 7/22 (32%)
leucine-rich repeat 285..308 CDD:275380 7/26 (27%)
leucine-rich repeat 309..334 CDD:275380 6/24 (25%)
leucine-rich repeat 335..358 CDD:275380 5/22 (23%)
leucine-rich repeat 359..382 CDD:275380 9/27 (33%)
leucine-rich repeat 383..406 CDD:275380 7/22 (32%)
leucine-rich repeat 407..430 CDD:275380 10/26 (38%)
leucine-rich repeat 431..451 CDD:275380 7/20 (35%)
leucine-rich repeat 454..477 CDD:275380 9/22 (41%)
leucine-rich repeat 478..499 CDD:275380 9/25 (36%)
leucine-rich repeat 502..525 CDD:275380 3/7 (43%)
leucine-rich repeat 526..548 CDD:275380
leucine-rich repeat 590..617 CDD:275380
leucine-rich repeat 618..641 CDD:275380
leucine-rich repeat 642..689 CDD:275380
LRRCT 679..736 CDD:214507
LRR <775..>920 CDD:443914
leucine-rich repeat 775..796 CDD:275380
leucine-rich repeat 797..817 CDD:275380
leucine-rich repeat 818..841 CDD:275380
leucine-rich repeat 842..865 CDD:275380
leucine-rich repeat 866..889 CDD:275380
leucine-rich repeat 890..911 CDD:275380
TIR 1045..1183 CDD:214587
RPP27NP_175849.2 LRRNT_2 130..174 CDD:462411
PLN00113 <229..>412 CDD:215061 69/219 (32%)
leucine-rich repeat 235..259 CDD:275380 11/48 (23%)
leucine-rich repeat 260..284 CDD:275380 9/27 (33%)
leucine-rich repeat 285..307 CDD:275380 8/25 (32%)
leucine-rich repeat 308..332 CDD:275380 8/23 (35%)
leucine-rich repeat 333..356 CDD:275380 8/22 (36%)
leucine-rich repeat 357..380 CDD:275380 9/22 (41%)
leucine-rich repeat 381..405 CDD:275380 10/27 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.