DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 18w and AT5G46260

DIOPT Version :10

Sequence 1:NP_476814.1 Gene:18w / 37277 FlyBaseID:FBgn0287775 Length:1385 Species:Drosophila melanogaster
Sequence 2:NP_199438.1 Gene:AT5G46260 / 834668 AraportID:AT5G46260 Length:1205 Species:Arabidopsis thaliana


Alignment Length:492 Identity:109/492 - (22%)
Similarity:194/492 - (39%) Gaps:148/492 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 VPPNAF-----EGLMSLKRL--TLESHNAVWGPGKTLEL--HGQSFQGLKELSELHL-----GDN 155
            |.||..     ||:.:.|.|  :||:       .|..||  |..:|:.::.|..|.:     |:.
plant   512 VDPNDICDVLSEGIDTQKVLGISLET-------SKIDELCVHESAFKRMRNLRFLKIGTDIFGEE 569

  Fly   156 NIRQLPEGVWCSMPSLQLLNLTQNRIRSAEFLGFSEKLCAGSALSNA------NGAV--SGGSEL 212
            |...|||......|:|:||..::..:|... ..|..|......::|:      .|||  :...|:
plant   570 NRLHLPESFDYLPPTLKLLCWSEFPMRCMP-SNFCPKNLVTLKMTNSKLHKLWEGAVPLTCLKEM 633

  Fly   213 QTLDVSFNELRSLPDAWGASRLRRLQTLSLQHNNISTLAPNALAGLSSLRVLNISY-NHLVSLPS 276
            . ||.|.| |:.:||   .|....|:||:.::.......|:.:..|:.|..||::: |.|.:||:
plant   634 D-LDGSVN-LKEIPD---LSMATNLETLNFENCKSLVELPSFIQNLNKLLKLNMAFCNSLETLPT 693

  Fly   277 ---------------------EAFAGNKELRELHLQGNDLYELPKGLLHRLEQLLVLDLSGNQLT 320
                                 ..|:.|  :.:|:|.|.::.|||..|  .||.|:.|.:|..:  
plant   694 GFNLKSLNRIDFTKCSKLRTFPDFSTN--ISDLYLTGTNIEELPSNL--HLENLIDLRISKKE-- 752

  Fly   321 SHHVDNSTFAGLIRLI--VLNLSNNALTRIGSK----------TFKELYFLQILDMRNNSIGHIE 373
               :|...:.|:::.:  :|.:.:..||.:..:          :|:.|..|::||:.|       
plant   753 ---IDGKQWEGVMKPLKPLLAMLSPTLTSLQLQNIPNLVELPCSFQNLIQLEVLDITN------- 807

  Fly   374 EGAFLPLYNLHTLNLAENRLHTLDNRIFNGLYVLTKLTLNNNLVSIVESQAFRNCSDLKELDLSS 438
                  ..||.||....| |.:||                        |.:|:.||.|:..    
plant   808 ------CRNLETLPTGIN-LQSLD------------------------SLSFKGCSRLRSF---- 837

  Fly   439 NQLTEVPEAVQDLSMLKTLDLGENQ----ISEFKNNTFRNLNQLTGLRLID------NRIGNITV 493
                  ||...::|.|...:.|..:    |.:|.|....::::.:.|:.:.      .|:|.:. 
plant   838 ------PEISTNISSLNLEETGIEEVPWWIDKFSNLGLLSMDRCSRLKCVSLHISKLKRLGKVD- 895

  Fly   494 GMFQDLPRLSVLNLA---------KNRIQSIERGAFD 521
              |:|...|::::|.         .|.|.::.:...|
plant   896 --FKDCGALTIVDLCGCPIGMEMEANNIDTVSKVKLD 930

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
18wNP_476814.1 leucine-rich repeat 66..91 CDD:275380
leucine-rich repeat 92..115 CDD:275380 5/14 (36%)
LRR_8 115..181 CDD:404697 20/74 (27%)
leucine-rich repeat 116..146 CDD:275380 9/33 (27%)
leucine-rich repeat 147..170 CDD:275380 7/27 (26%)
leucine-rich repeat 171..201 CDD:275380 6/29 (21%)
LRR 210..592 CDD:443914 77/365 (21%)
leucine-rich repeat 212..236 CDD:275380 8/23 (35%)
leucine-rich repeat 237..260 CDD:275380 5/22 (23%)
leucine-rich repeat 261..284 CDD:275380 9/44 (20%)
leucine-rich repeat 285..308 CDD:275380 8/22 (36%)
leucine-rich repeat 309..334 CDD:275380 5/24 (21%)
leucine-rich repeat 335..358 CDD:275380 5/34 (15%)
leucine-rich repeat 359..382 CDD:275380 4/22 (18%)
leucine-rich repeat 383..406 CDD:275380 7/22 (32%)
leucine-rich repeat 407..430 CDD:275380 3/22 (14%)
leucine-rich repeat 431..451 CDD:275380 3/19 (16%)
leucine-rich repeat 454..477 CDD:275380 5/26 (19%)
leucine-rich repeat 478..499 CDD:275380 4/26 (15%)
leucine-rich repeat 502..525 CDD:275380 5/29 (17%)
leucine-rich repeat 526..548 CDD:275380
leucine-rich repeat 590..617 CDD:275380
leucine-rich repeat 618..641 CDD:275380
leucine-rich repeat 642..689 CDD:275380
LRRCT 679..736 CDD:214507
LRR <775..>920 CDD:443914
leucine-rich repeat 775..796 CDD:275380
leucine-rich repeat 797..817 CDD:275380
leucine-rich repeat 818..841 CDD:275380
leucine-rich repeat 842..865 CDD:275380
leucine-rich repeat 866..889 CDD:275380
leucine-rich repeat 890..911 CDD:275380
TIR 1045..1183 CDD:214587
AT5G46260NP_199438.1 PLN03210 1..1157 CDD:215633 109/492 (22%)
leucine-rich repeat 630..652 CDD:275380 9/26 (35%)
leucine-rich repeat 653..676 CDD:275380 5/22 (23%)
leucine-rich repeat 677..699 CDD:275380 7/21 (33%)
leucine-rich repeat 700..720 CDD:275380 1/19 (5%)
leucine-rich repeat 721..742 CDD:275380 8/22 (36%)
leucine-rich repeat 743..775 CDD:275380 6/36 (17%)
leucine-rich repeat 776..799 CDD:275380 4/22 (18%)
leucine-rich repeat 800..822 CDD:275380 10/35 (29%)
leucine-rich repeat 823..843 CDD:275380 9/53 (17%)
leucine-rich repeat 844..867 CDD:275380 5/22 (23%)
leucine-rich repeat 870..901 CDD:275378 5/33 (15%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.