DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 18w and RLP48

DIOPT Version :9

Sequence 1:NP_476814.1 Gene:18w / 37277 FlyBaseID:FBgn0004364 Length:1385 Species:Drosophila melanogaster
Sequence 2:NP_193124.2 Gene:RLP48 / 827022 AraportID:AT4G13880 Length:725 Species:Arabidopsis thaliana


Alignment Length:711 Identity:165/711 - (23%)
Similarity:254/711 - (35%) Gaps:175/711 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 RLRRLQTLSLQHNNISTLAPNALAGLSSLRVLNISYNHLVSLPSEAFAGNKELRELHLQGNDLYE 297
            ||:.||:|.|..||||.:.|:::..|..||.|:                   .|..||.|    :
plant   110 RLQHLQSLELSSNNISGILPDSIGNLKYLRSLS-------------------FRTCHLFG----K 151

  Fly   298 LPKGLLHRLEQLLVLDLSGNQLTSHHVD---NSTFAGLIRLIVLNLSNNALTRIGSKTFKELYFL 359
            :|.. |..|..|..||||.|..||...|   |......::|::||||:.....:||...|     
plant   152 IPSS-LGSLSYLTHLDLSYNDFTSEGPDSGGNLNRLTDLQLVLLNLSSVTWIDLGSNQLK----- 210

  Fly   360 QILDMRNNSIGHIEEGAFLPLYNLHTLNLAE-NRLHTLDNRIFNGLYVLTKLTLNNNLVSIVESQ 423
                    ..|.::...||.|.:|.:|:|:. |....:|...|:.|..|.:|.|:...:.|..:.
plant   211 --------GRGIVDFSIFLHLKSLCSLDLSYLNTRSMVDLSFFSHLMSLDELDLSGINLKISSTL 267

  Fly   424 AFRNCSDLKELDLSSNQLTEVPEAVQDLSMLKTLDLGENQISEFKNNTFRNLNQLTGLRLIDNRI 488
            :|.:.:.  .|.|:|..:.|.|:.:::.:.|..||:..|.|.                       
plant   268 SFPSATG--TLILASCNIVEFPKFLENQTSLFYLDISANHIE----------------------- 307

  Fly   489 GNITVGMFQDLPRLSVLNLAKNRIQSIERGAFD--KNTEIEAIRLDKNFLTDINGIFATLASLLW 551
            |.:...::: ||.||.:|:|:|...    |...  .|:....|..|..|..:|......|.||..
plant   308 GQVPEWLWR-LPTLSFVNIAQNSFS----GELPMLPNSIYSFIASDNQFSGEIPRTVCELVSLNT 367

  Fly   552 LNLSENHLVWFDYAFIP---SNLKWLDI-HGNYIEALGNYYKLQEEIRVTTLDASHNRITEIGAM 612
            |.||.|..    ...||   .|.|.:.| |.......|.:.|......:|:||..||.::.....
plant   368 LVLSNNKF----SGSIPRCFENFKTISILHLRNNSLSGVFPKEIISETLTSLDVGHNWLSGQLPK 428

  Fly   613 SVPNSIELLFINNNIIGQIQANTFVDKTRLARVDLYANVLSKISLNALRVAPVSAEKPVPEFYLG 677
            |:....:|.|:|      ::.|...||     ...:...||.:.:..||         ..|||  
plant   429 SLIKCTDLEFLN------VEDNRINDK-----FPFWLRSLSNLQILVLR---------SNEFY-- 471

  Fly   678 GNPFECDCSMEWLQ-RINNLTTRQHPHVVDLGNIECLMPHSRSAPLRPLASLSA-SDFVCKYESH 740
            |..|..:.|:.:.: ||.:::......|:               |....|..|| |..|..::: 
plant   472 GPIFSLEDSLSFPKLRIFDISENHFTGVL---------------PSDYFAGWSAMSSVVDIFDT- 520

  Fly   741 CPPTCHCCEYEQCECEVICPGNCSCFHDATWATN------IVDCGRQDLAALPNRIPQDVSDLYL 799
             .|..|.....|           ..:|::...||      :|..|......:      |||...|
plant   521 -TPQVHILGVFQ-----------GYYHNSVVLTNKGLNMELVGSGFTIYKTI------DVSGNRL 567

  Fly   800 DGNNMPELEVGHLTGRRNLRALYLNASNLMTLQNGSLAQLVNLRVLHLENNKLTALEGTEFRSLG 864
            :| ::||                            |:..|..|.||::.||..|........:|.
plant   568 EG-DIPE----------------------------SIGILKELIVLNMSNNAFTGHIPPSLSNLS 603

  Fly   865 LLRELYLHNNMLTHISNATFEPLVSLEVLRLDNNRLSS-LPHLQYRHSLQGLTLGRNAWSC 924
            .|:.|.|..|.|:.........|..||.:....|||.. :|......|....:...|...|
plant   604 NLQSLDLSQNRLSGSIPPELGKLTFLEWMNFSYNRLEGPIPQATQIQSQNSSSFAENPGLC 664

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
18wNP_476814.1 leucine-rich repeat 66..91 CDD:275380
leucine-rich repeat 92..115 CDD:275380
LRR_8 115..181 CDD:290566
leucine-rich repeat 116..146 CDD:275380
leucine-rich repeat 147..170 CDD:275380
leucine-rich repeat 171..201 CDD:275380
LRR_RI 210..464 CDD:238064 65/234 (28%)
leucine-rich repeat 212..236 CDD:275380 2/2 (100%)
LRR_8 235..295 CDD:290566 17/59 (29%)
leucine-rich repeat 237..260 CDD:275380 10/22 (45%)
leucine-rich repeat 261..284 CDD:275380 3/22 (14%)
LRR_8 283..345 CDD:290566 22/64 (34%)
leucine-rich repeat 285..308 CDD:275380 7/22 (32%)
leucine-rich repeat 309..334 CDD:275380 10/27 (37%)
LRR_8 334..393 CDD:290566 16/59 (27%)
leucine-rich repeat 335..358 CDD:275380 8/22 (36%)
leucine-rich repeat 359..382 CDD:275380 4/22 (18%)
LRR_8 382..441 CDD:290566 15/59 (25%)
leucine-rich repeat 383..406 CDD:275380 7/23 (30%)
leucine-rich repeat 407..430 CDD:275380 5/22 (23%)
LRR_8 431..488 CDD:290566 10/56 (18%)
leucine-rich repeat 431..451 CDD:275380 5/19 (26%)
leucine-rich repeat 454..477 CDD:275380 5/22 (23%)
LRR_8 477..559 CDD:290566 21/83 (25%)
leucine-rich repeat 478..499 CDD:275380 1/20 (5%)
leucine-rich repeat 502..525 CDD:275380 7/24 (29%)
leucine-rich repeat 526..548 CDD:275380 5/21 (24%)
leucine-rich repeat 590..617 CDD:275380 6/26 (23%)
leucine-rich repeat 618..641 CDD:275380 6/22 (27%)
leucine-rich repeat 642..689 CDD:275380 10/46 (22%)
LRRCT 679..736 CDD:214507 11/58 (19%)
leucine-rich repeat 775..796 CDD:275380 4/20 (20%)
LRR_8 797..852 CDD:290566 11/54 (20%)
leucine-rich repeat 797..817 CDD:275380 4/19 (21%)
leucine-rich repeat 818..841 CDD:275380 2/22 (9%)
LRR_8 841..900 CDD:290566 16/58 (28%)
leucine-rich repeat 842..865 CDD:275380 7/22 (32%)
LRR_4 866..907 CDD:289563 12/41 (29%)
leucine-rich repeat 866..889 CDD:275380 6/22 (27%)
leucine-rich repeat 890..911 CDD:275380 6/21 (29%)
TIR 1045..1183 CDD:214587
RLP48NP_193124.2 LRRNT_2 35..82 CDD:285463
LRR_RI 108..334 CDD:238064 75/290 (26%)
leucine-rich repeat 114..137 CDD:275380 10/22 (45%)
leucine-rich repeat 138..161 CDD:275380 10/46 (22%)
leucine-rich repeat 162..185 CDD:275380 10/22 (45%)
leucine-rich repeat 199..225 CDD:275380 7/38 (18%)
LRR 214..>503 CDD:227223 80/359 (22%)
leucine-rich repeat 226..250 CDD:275380 7/23 (30%)
leucine-rich repeat 251..272 CDD:275380 5/20 (25%)
leucine-rich repeat 273..295 CDD:275380 5/23 (22%)
leucine-rich repeat 296..317 CDD:275380 6/44 (14%)
leucine-rich repeat 320..364 CDD:275380 12/47 (26%)
LRR_RI 347..>470 CDD:238064 34/146 (23%)
leucine-rich repeat 365..388 CDD:275380 8/26 (31%)
leucine-rich repeat 389..415 CDD:275380 5/25 (20%)
leucine-rich repeat 416..435 CDD:275380 4/18 (22%)
leucine-rich repeat 436..459 CDD:275380 7/33 (21%)
leucine-rich repeat 460..485 CDD:275380 8/35 (23%)
leucine-rich repeat 486..542 CDD:275380 13/83 (16%)
leucine-rich repeat 549..580 CDD:275380 11/65 (17%)
LRR_8 558..615 CDD:290566 20/91 (22%)
leucine-rich repeat 581..604 CDD:275380 7/22 (32%)
leucine-rich repeat 605..628 CDD:275380 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.