DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 18w and AT3G56370

DIOPT Version :10

Sequence 1:NP_476814.1 Gene:18w / 37277 FlyBaseID:FBgn0287775 Length:1385 Species:Drosophila melanogaster
Sequence 2:NP_191196.1 Gene:AT3G56370 / 824804 AraportID:AT3G56370 Length:964 Species:Arabidopsis thaliana


Alignment Length:595 Identity:153/595 - (25%)
Similarity:241/595 - (40%) Gaps:152/595 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IITIIAVAAC----------------LLLLVADAHAQQQ------------CNWQYGLTTMDIRC 43
            |.|::.|:|.                |::..||....:|            |:|.      .::|
plant     6 IFTVLLVSAVAPVRSLDPPLNDDVLGLIVFKADLRDPEQKLASWNEDDYTPCSWN------GVKC 64

  Fly    44 SVRALESGTGTPLDLQVAEAAGRLDLQCSQ-ELLHASELA---------PGLFRQLQKLSELRID 98
            ..|   :...|.|:|.....:||:.....| :.||...|:         |.:...|..|..:.:.
plant    65 HPR---TNRVTELNLDGFSLSGRIGRGLLQLQFLHKLSLSNNNLTGIINPNMLLSLVNLKVVDLS 126

  Fly    99 ACKLQ-RVPPNAFEGLMSLKRLTLESHNAVWGPGKTLELHGQ---SFQGLKELSELHLGDNNIR- 158
            :..|. .:|...|....||:.|:|..:          :|.|:   |......|:.|:|..|... 
plant   127 SNGLSGSLPDEFFRQCGSLRVLSLAKN----------KLTGKIPVSISSCSSLAALNLSSNGFSG 181

  Fly   159 QLPEGVWCSMPSLQLLNLTQNRIRSAEFLGFSEKLCAGSALSNANGAVSG------GS--ELQTL 215
            .:|.|:| |:.:|:.|:|::|.: ..||....::|....||..:...:||      ||  .|:|:
plant   182 SMPLGIW-SLNTLRSLDLSRNEL-EGEFPEKIDRLNNLRALDLSRNRLSGPIPSEIGSCMLLKTI 244

  Fly   216 DVSFNELR-SLPDA-----------------------WGASRLRRLQTLSLQHNNISTLAPNALA 256
            |:|.|.|. |||:.                       | ...:|.|:||.|..|..|...|:::.
plant   245 DLSENSLSGSLPNTFQQLSLCYSLNLGKNALEGEVPKW-IGEMRSLETLDLSMNKFSGQVPDSIG 308

  Fly   257 GLSSLRVLNISYNHLV-SLP-SEAFAGNKELRELHLQGNDLYELPKGLLHRLEQLLVLDLSGNQL 319
            .|.:|:|||.|.|.|: ||| |.|...|                          ||.||||||.|
plant   309 NLLALKVLNFSGNGLIGSLPVSTANCIN--------------------------LLALDLSGNSL 347

  Fly   320 T-----------SHHV-----DNSTFAGLIRLIVLNLSNNALT-RIGSKTFKELYFLQILDMRNN 367
            |           |..|     |||| .|:.::.||:||:||.: .||: ...:|..|:.|.:..|
plant   348 TGKLPMWLFQDGSRDVSALKNDNST-GGIKKIQVLDLSHNAFSGEIGA-GLGDLRDLEGLHLSRN 410

  Fly   368 SIGHIEEGAFLPLYNLHTLNLAENRLHTLDNRIFNGLYVLTKLTLNNNLVSIVESQAFRNCSDLK 432
            |:..........|.:|..|:::.|:|:.:..|...|...|.:|.|.|||:......:.:|||.|:
plant   411 SLTGPIPSTIGELKHLSVLDVSHNQLNGMIPRETGGAVSLEELRLENNLLEGNIPSSIKNCSSLR 475

  Fly   433 ELDLSSNQLT-EVPEAVQDLSMLKTLDLGENQISEFKNNTFRNLNQLTGLRLIDNRIGNITVGMF 496
            .|.||.|:|. .:|..:..|:.|:.:||..|:::........||..|....:..|.       :|
plant   476 SLILSHNKLLGSIPPELAKLTRLEEVDLSFNELAGTLPKQLANLGYLHTFNISHNH-------LF 533

  Fly   497 QDLPRLSVLN 506
            .:||...:.|
plant   534 GELPAGGIFN 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
18wNP_476814.1 leucine-rich repeat 66..91 CDD:275380 7/34 (21%)
leucine-rich repeat 92..115 CDD:275380 4/23 (17%)
LRR_8 115..181 CDD:404697 19/69 (28%)
leucine-rich repeat 116..146 CDD:275380 6/32 (19%)
leucine-rich repeat 147..170 CDD:275380 8/23 (35%)
leucine-rich repeat 171..201 CDD:275380 9/29 (31%)
LRR 210..592 CDD:443914 99/343 (29%)
leucine-rich repeat 212..236 CDD:275380 10/47 (21%)
leucine-rich repeat 237..260 CDD:275380 8/22 (36%)
leucine-rich repeat 261..284 CDD:275380 13/24 (54%)
leucine-rich repeat 285..308 CDD:275380 0/22 (0%)
leucine-rich repeat 309..334 CDD:275380 17/40 (43%)
leucine-rich repeat 335..358 CDD:275380 9/23 (39%)
leucine-rich repeat 359..382 CDD:275380 5/22 (23%)
leucine-rich repeat 383..406 CDD:275380 6/22 (27%)
leucine-rich repeat 407..430 CDD:275380 8/22 (36%)
leucine-rich repeat 431..451 CDD:275380 7/20 (35%)
leucine-rich repeat 454..477 CDD:275380 6/22 (27%)
leucine-rich repeat 478..499 CDD:275380 3/20 (15%)
leucine-rich repeat 502..525 CDD:275380 1/5 (20%)
leucine-rich repeat 526..548 CDD:275380
leucine-rich repeat 590..617 CDD:275380
leucine-rich repeat 618..641 CDD:275380
leucine-rich repeat 642..689 CDD:275380
LRRCT 679..736 CDD:214507
LRR <775..>920 CDD:443914
leucine-rich repeat 775..796 CDD:275380
leucine-rich repeat 797..817 CDD:275380
leucine-rich repeat 818..841 CDD:275380
leucine-rich repeat 842..865 CDD:275380
leucine-rich repeat 866..889 CDD:275380
leucine-rich repeat 890..911 CDD:275380
TIR 1045..1183 CDD:214587
AT3G56370NP_191196.1 PLN00113 32..948 CDD:215061 149/569 (26%)
leucine-rich repeat 71..94 CDD:275380 6/22 (27%)
leucine-rich repeat 95..119 CDD:275380 5/23 (22%)
leucine-rich repeat 120..144 CDD:275380 4/23 (17%)
leucine-rich repeat 145..168 CDD:275380 6/32 (19%)
leucine-rich repeat 169..192 CDD:275380 8/23 (35%)
leucine-rich repeat 193..216 CDD:275380 7/23 (30%)
leucine-rich repeat 217..240 CDD:275380 6/22 (27%)
leucine-rich repeat 241..288 CDD:275380 10/47 (21%)
leucine-rich repeat 265..287 CDD:275378 1/22 (5%)
leucine-rich repeat 289..312 CDD:275380 8/22 (36%)
leucine-rich repeat 313..336 CDD:275380 12/22 (55%)
leucine-rich repeat 337..377 CDD:275380 17/40 (43%)
leucine-rich repeat 378..401 CDD:275380 9/23 (39%)
leucine-rich repeat 402..425 CDD:275380 5/22 (23%)
leucine-rich repeat 426..449 CDD:275380 6/22 (27%)
leucine-rich repeat 450..473 CDD:275380 8/22 (36%)
leucine-rich repeat 474..497 CDD:275380 8/22 (36%)
leucine-rich repeat 498..521 CDD:275380 6/22 (27%)
leucine-rich repeat 522..545 CDD:275380 6/29 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.