DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 18w and LRRTM4

DIOPT Version :9

Sequence 1:NP_476814.1 Gene:18w / 37277 FlyBaseID:FBgn0004364 Length:1385 Species:Drosophila melanogaster
Sequence 2:NP_001317299.1 Gene:LRRTM4 / 80059 HGNCID:19411 Length:591 Species:Homo sapiens


Alignment Length:664 Identity:145/664 - (21%)
Similarity:227/664 - (34%) Gaps:219/664 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 MPSLQLLNLTQNRIRSAEFLGFSEKL--CAGSALSNANGAVSGGSELQTLDVSFNELRSLPDAWG 230
            :|:|.|:.||..:....:......|:  |...|.::....:||||                    
Human    20 LPTLLLVMLTGAQRACPKNCRCDGKIVYCESHAFADIPENISGGS-------------------- 64

  Fly   231 ASRLRRLQTLSLQHNNISTLAPNALAGLSSLRVLNISYNHLVSLPSEAFAGNKELRELHLQGNDL 295
                   |.|||:.|:|..|..|..|||:.|..|.:.:|::.|:..:||.|.:.|:|        
Human    65 -------QGLSLRFNSIQKLKSNQFAGLNQLIWLYLDHNYISSVDEDAFQGIRRLKE-------- 114

  Fly   296 YELPKGLLHRLEQLLVLDLSGNQLTSHHVDNSTFAGLIRLIVLNLSNNALTRIGSKTFKELYFLQ 360
                                                      |.||:|.:|.:.:|||.      
Human   115 ------------------------------------------LILSSNKITYLHNKTFH------ 131

  Fly   361 ILDMRNNSIGHIEEGAFLPLYNLHTLNLAENRLHTLDNRIFNGLYVLTKLTLNNNLVSIVESQAF 425
                              |:.||..|:|:.|:|.||.:..|.||..|..|.|.:|.:..|..:.|
Human   132 ------------------PVPNLRNLDLSYNKLQTLQSEQFKGLRKLIILHLRSNSLKTVPIRVF 178

  Fly   426 RNCSDLKELDLSSNQLTEVP-EAVQDLSMLKTLDLGENQISEFKNNTFRNLNQLTGLRLIDNRIG 489
            ::|.:|..|||..|:|..:. .|...|..||.|.|..||.|:.....|..|..|..:.|..|||.
Human   179 QDCRNLDFLDLGYNRLRSLSRNAFAGLLKLKELHLEHNQFSKINFAHFPRLFNLRSIYLQWNRIR 243

  Fly   490 NITVGMFQDLPRLSVLNLAKNRIQSIERGAFDKNTEIEAIRLDKNFLTDIN--GIFATLASLLWL 552
            :|:.|:......|..|:|:.|.||.||.|.|.....::.:.||.|.||:|:  .:.|.: ||:.:
Human   244 SISQGLTWTWSSLHNLDLSGNDIQGIEPGTFKCLPNLQKLNLDSNKLTNISQETVNAWI-SLISI 307

  Fly   553 NLSENHLVWFDYAFIPSNLKWL-----------------DIHGNYIEALGNYYKLQEEIRVTTLD 600
            .||.|  :|.....|.....||                 .|.|..:......|.:..|::|...:
Human   308 TLSGN--MWECSRSICPLFYWLKNFKGNKESTMICAGPKHIQGEKVSDAVETYNICSEVQVVNTE 370

  Fly   601 ASH-------------------NRITE--------IGAMSVPNSIE---------------LLFI 623
            .||                   ..:|:        .....:|.:.:               .||:
Human   371 RSHLVPQTPQKPLIIPRPTIFKPDVTQSTFETPSPSPGFQIPGAEQEYEHVSFHKIIAGSVALFL 435

  Fly   624 NNNIIGQIQANTFVDKTR--LARVDLYANVLSKISLNALRVAPVSAEKPVPEFYLGGNPFECDCS 686
            :   :..|....:|...|  .:...|..:.|.|......|.:......|:.|:|:...|      
Human   436 S---VAMILLVIYVSWKRYPASMKQLQQHSLMKRRRKKARESERQMNSPLQEYYVDYKP------ 491

  Fly   687 MEWLQRINNLTTRQHPHVVDL-------------GNIECLMPHSRSAPLRPLASLSASDFVCKYE 738
                         .:...:|:             |:.||.|||.    ::||          .|.
Human   492 -------------TNSETMDISVNGSGPCTYTISGSRECEMPHH----MKPL----------PYY 529

  Fly   739 SHCPPTCHCCEYEQ 752
            |:..|....|:..|
Human   530 SYDQPVIGYCQAHQ 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
18wNP_476814.1 leucine-rich repeat 66..91 CDD:275380
leucine-rich repeat 92..115 CDD:275380
LRR_8 115..181 CDD:290566 5/12 (42%)
leucine-rich repeat 116..146 CDD:275380
leucine-rich repeat 147..170 CDD:275380 0/1 (0%)
leucine-rich repeat 171..201 CDD:275380 7/31 (23%)
LRR_RI 210..464 CDD:238064 61/254 (24%)
leucine-rich repeat 212..236 CDD:275380 0/23 (0%)
LRR_8 235..295 CDD:290566 20/59 (34%)
leucine-rich repeat 237..260 CDD:275380 11/22 (50%)
leucine-rich repeat 261..284 CDD:275380 7/22 (32%)
LRR_8 283..345 CDD:290566 6/61 (10%)
leucine-rich repeat 285..308 CDD:275380 2/22 (9%)
leucine-rich repeat 309..334 CDD:275380 0/24 (0%)
LRR_8 334..393 CDD:290566 14/58 (24%)
leucine-rich repeat 335..358 CDD:275380 8/22 (36%)
leucine-rich repeat 359..382 CDD:275380 1/22 (5%)
LRR_8 382..441 CDD:290566 23/58 (40%)
leucine-rich repeat 383..406 CDD:275380 10/22 (45%)
leucine-rich repeat 407..430 CDD:275380 7/22 (32%)
LRR_8 431..488 CDD:290566 20/57 (35%)
leucine-rich repeat 431..451 CDD:275380 7/20 (35%)
leucine-rich repeat 454..477 CDD:275380 9/22 (41%)
LRR_8 477..559 CDD:290566 29/83 (35%)
leucine-rich repeat 478..499 CDD:275380 7/20 (35%)
leucine-rich repeat 502..525 CDD:275380 10/22 (45%)
leucine-rich repeat 526..548 CDD:275380 7/23 (30%)
leucine-rich repeat 590..617 CDD:275380 6/53 (11%)
leucine-rich repeat 618..641 CDD:275380 4/37 (11%)
leucine-rich repeat 642..689 CDD:275380 8/46 (17%)
LRRCT 679..736 CDD:214507 10/69 (14%)
leucine-rich repeat 775..796 CDD:275380
LRR_8 797..852 CDD:290566
leucine-rich repeat 797..817 CDD:275380
leucine-rich repeat 818..841 CDD:275380
LRR_8 841..900 CDD:290566
leucine-rich repeat 842..865 CDD:275380
LRR_4 866..907 CDD:289563
leucine-rich repeat 866..889 CDD:275380
leucine-rich repeat 890..911 CDD:275380
TIR 1045..1183 CDD:214587
LRRTM4NP_001317299.1 leucine-rich repeat 44..62 CDD:275380 3/17 (18%)
leucine-rich repeat 65..87 CDD:275380 11/21 (52%)
LRR_RI <85..291 CDD:238064 74/279 (27%)
LRR_8 87..146 CDD:290566 23/132 (17%)
leucine-rich repeat 88..111 CDD:275380 7/22 (32%)
leucine-rich repeat 112..135 CDD:275380 11/96 (11%)
LRR_8 134..194 CDD:290566 23/59 (39%)
leucine-rich repeat 136..159 CDD:275380 10/22 (45%)
leucine-rich repeat 160..183 CDD:275380 7/22 (32%)
leucine-rich repeat 184..207 CDD:275380 8/22 (36%)
leucine-rich repeat 208..231 CDD:275380 9/22 (41%)
LRR_8 231..290 CDD:290566 20/58 (34%)
leucine-rich repeat 232..255 CDD:275380 7/22 (32%)
leucine-rich repeat 256..279 CDD:275380 10/22 (45%)
leucine-rich repeat 304..316 CDD:275378 5/13 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.