DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 18w and LRFN3

DIOPT Version :10

Sequence 1:NP_476814.1 Gene:18w / 37277 FlyBaseID:FBgn0287775 Length:1385 Species:Drosophila melanogaster
Sequence 2:NP_078785.1 Gene:LRFN3 / 79414 HGNCID:28370 Length:628 Species:Homo sapiens


Alignment Length:185 Identity:58/185 - (31%)
Similarity:92/185 - (49%) Gaps:11/185 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 AGLI--------RLIVLNLSNNALTRIGSKTFKELYFLQILDMRNNSIGHIEEGAFLPLYNLHTL 386
            |||:        |...|.|::|.:..:..:....:..|..|.:..|:|.|:..|||..|..|..|
Human    48 AGLLFVPPSLDRRAAELRLADNFIASVRRRDLANMTGLLHLSLSRNTIRHVAAGAFADLRALRAL 112

  Fly   387 NLAENRLHTLDNRIFNGLYVLTKLTLNNNLVSIVESQAFRNCSD-LKELDLSSNQLTEVP-EAVQ 449
            :|..|||.:|......||..|..|.|:||.::.:.:.|..:|:: |::||||.|.|.::| ||:.
Human   113 HLDGNRLTSLGEGQLRGLVNLRHLILSNNQLAALAAGALDDCAETLEDLDLSYNNLEQLPWEALG 177

  Fly   450 DLSMLKTLDLGENQISEFKNNTFRNLNQLTGLRLIDNRIGNITVG-MFQDLPRLS 503
            .|..:.||.|..|.::......|..|::|..|.:..||:..|... :|..||.|:
Human   178 RLGNVNTLGLDHNLLASVPAGAFSRLHKLARLDMTSNRLTTIPPDPLFSRLPLLA 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
18wNP_476814.1 leucine-rich repeat 66..91 CDD:275380
leucine-rich repeat 92..115 CDD:275380
LRR_8 115..181 CDD:404697
leucine-rich repeat 116..146 CDD:275380
leucine-rich repeat 147..170 CDD:275380
leucine-rich repeat 171..201 CDD:275380
LRR 210..592 CDD:443914 58/185 (31%)
leucine-rich repeat 212..236 CDD:275380
leucine-rich repeat 237..260 CDD:275380
leucine-rich repeat 261..284 CDD:275380
leucine-rich repeat 285..308 CDD:275380
leucine-rich repeat 309..334 CDD:275380 3/11 (27%)
leucine-rich repeat 335..358 CDD:275380 3/22 (14%)
leucine-rich repeat 359..382 CDD:275380 9/22 (41%)
leucine-rich repeat 383..406 CDD:275380 9/22 (41%)
leucine-rich repeat 407..430 CDD:275380 7/22 (32%)
leucine-rich repeat 431..451 CDD:275380 10/20 (50%)
leucine-rich repeat 454..477 CDD:275380 6/22 (27%)
leucine-rich repeat 478..499 CDD:275380 6/21 (29%)
leucine-rich repeat 502..525 CDD:275380 1/2 (50%)
leucine-rich repeat 526..548 CDD:275380
leucine-rich repeat 590..617 CDD:275380
leucine-rich repeat 618..641 CDD:275380
leucine-rich repeat 642..689 CDD:275380
LRRCT 679..736 CDD:214507
LRR <775..>920 CDD:443914
leucine-rich repeat 775..796 CDD:275380
leucine-rich repeat 797..817 CDD:275380
leucine-rich repeat 818..841 CDD:275380
leucine-rich repeat 842..865 CDD:275380
leucine-rich repeat 866..889 CDD:275380
leucine-rich repeat 890..911 CDD:275380
TIR 1045..1183 CDD:214587
LRFN3NP_078785.1 LRR 1 60..83 4/22 (18%)
LRR <63..>228 CDD:443914 51/164 (31%)
leucine-rich repeat 63..84 CDD:275380 3/20 (15%)
LRR 2 84..105 8/20 (40%)
leucine-rich repeat 85..108 CDD:275380 9/22 (41%)
LRR 3 108..129 7/20 (35%)
leucine-rich repeat 109..132 CDD:275380 9/22 (41%)
LRR 4 132..153 6/20 (30%)
leucine-rich repeat 133..157 CDD:275380 7/23 (30%)
LRR 5 157..178 10/20 (50%)
leucine-rich repeat 158..181 CDD:275380 11/22 (50%)
LRR 6 181..202 5/20 (25%)
leucine-rich repeat 182..205 CDD:275380 6/22 (27%)
LRR 7 205..226 5/20 (25%)
leucine-rich repeat 206..230 CDD:275380 7/23 (30%)
leucine-rich repeat 242..253 CDD:275378
LRRCT 249..>281 CDD:214507
Ig 296..383 CDD:472250
Ig strand B 313..317 CDD:409353
Ig strand C 326..330 CDD:409353
Ig strand E 349..353 CDD:409353
Ig strand F 363..368 CDD:409353
Ig strand G 376..379 CDD:409353
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 382..430
fn3 424..502 CDD:394996
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.