DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 18w and trn

DIOPT Version :9

Sequence 1:NP_476814.1 Gene:18w / 37277 FlyBaseID:FBgn0004364 Length:1385 Species:Drosophila melanogaster
Sequence 2:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster


Alignment Length:804 Identity:172/804 - (21%)
Similarity:279/804 - (34%) Gaps:283/804 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 GVWCSM------PSLQLLNLTQNRIRSAEFLGFSEKLCAGSALSNANGAV--SGGSELQTLDVSF 219
            |:||.:      |:..|.|                  |......:.|..|  .|..:|..|.::.
  Fly    11 GIWCILASIGVEPAAGLAN------------------CPPGCQCDDNTLVVQCGEGQLDVLPIAL 57

  Fly   220 NELRSLPDAWGASRLRRLQTLSLQHNNISTLAPNALAGLSSLRVLNISYNHLVSLPSEAFAGNKE 284
            |.              .:|.|.::.|.|.|: .:::...:.|..|::|.|||:::|...||..|:
  Fly    58 NP--------------SIQRLVIKSNKIKTI-DSSIQFYAELTFLDLSSNHLMTIPQRTFAYQKK 107

  Fly   285 LRELHLQGNDLYELPKGLLHRLEQLLVLDLSGNQLTSHHVDNSTFAGLIRLIVLNLSNNALTRIG 349
            |:|:||..|.:.:                          :.|.||.||..:.||||         
  Fly   108 LQEVHLNHNKIGQ--------------------------ISNKTFIGLSAVTVLNL--------- 137

  Fly   350 SKTFKELYFLQILDMRNNSIGHIEEGAFLPLYNLHTLNLAENRLHTLDNRIFNGLYVLTKLTLNN 414
                           |.|.|..:.:|.|.||..:..|||.|||:..||.:.|:||..|..|.|::
  Fly   138 ---------------RGNQISELHQGTFTPLLKIEELNLGENRIGYLDPKAFDGLSQLRILYLDD 187

  Fly   415 N-LVSIVESQAFRNCSDLKELDLSSNQLTEV-PEAVQDLSMLKTLDLGENQISEFKNNTFRNLNQ 477
            | |.::.:...|:....|.||.|..|.|..: .:|.|||..|..|:|....:....:::|..|.:
  Fly   188 NALTTVPDPVIFQAMPSLAELFLGMNTLQSIQADAFQDLKGLTRLELKGASLRNISHDSFLGLQE 252

  Fly   478 LTGLRLIDNRIGNI-TVGMFQDLPRLSVLNLAKNRIQSIERGAFD-----KNTEIE-AIRLDKNF 535
            |..|.|.|||:..| :||: ..|.||..|:|.:|..:.|..|||.     |..|:. |:|| |..
  Fly   253 LRILDLSDNRLDRIPSVGL-SKLVRLEQLSLGQNDFEVISEGAFMGLKQLKRLEVNGALRL-KRV 315

  Fly   536 LTDINGIFATLASLLWLNLSENHLVWFDYAFIPSNLKWLDIHGNYIEALGNYYKLQEEIRVTTLD 600
            :|   |.|:...:|.:||||.|.::                           .::||        
  Fly   316 MT---GAFSDNGNLEYLNLSSNKML---------------------------LEVQE-------- 342

  Fly   601 ASHNRITEIGAMSVPNSIELLFINNNIIGQIQANTFVDKTRLARVDLYANVLSKISLNALRVAPV 665
                     ||:|                        ..::|..|.|.||.|:.:          
  Fly   343 ---------GALS------------------------GLSQLKHVVLKANALTSL---------- 364

  Fly   666 SAE-----KPVPEFYLGGNPFECDCSMEWLQRINNLTTRQHPHVVDLGNIECLMPHS-RSAPLRP 724
             ||     |.:....|..||..|||.:.||   :||...::....|:..:.|..|.. |...|| 
  Fly   365 -AEGLFPWKDLQTLDLSENPLSCDCRVMWL---HNLLVAKNASQDDVSELLCEFPERLRGESLR- 424

  Fly   725 LASLSASDFVCKYESHCPPTCHCCEY----EQCECEVICPGNCS-----------CFH------- 767
                           |..|....|.:    :|.....:..|:.:           |.|       
  Fly   425 ---------------HLNPAMMGCTHADPRKQALIGALLVGSAATITALALVLYRCRHKIRETIK 474

  Fly   768 DATWATNIVDCGRQD---------------------LAALPNRIPQDVSDLYLDGNN-------M 804
            ...|..:.:  ||::                     ...:.:..|...:..:..|..       |
  Fly   475 GGLWGNSAL--GRKEREYQKTFCDEDYMSRHQHHPCSLGIHSTFPNTYTAPHHPGATHHYGMCPM 537

  Fly   805 PELEVGHLTGRRNLRALYLNASNLMTLQNGSLAQLVNLRVLHLENNKLTALEGT---------EF 860
            |..::|.:..::..:.|.:..:.:::.:.             |.|||....:|.         ..
  Fly   538 PVNDLGAIDPQQKFQQLVVPTATMISEKK-------------LNNNKALVSQGAIDDSASFVLHM 589

  Fly   861 RSLGLLRELYLHNNMLTHISNATF 884
            :|..:.|:::..|..|.|.:...|
  Fly   590 KSATMGRDVHQQNPQLNHYTKPQF 613

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
18wNP_476814.1 leucine-rich repeat 66..91 CDD:275380
leucine-rich repeat 92..115 CDD:275380
LRR_8 115..181 CDD:290566 6/23 (26%)
leucine-rich repeat 116..146 CDD:275380
leucine-rich repeat 147..170 CDD:275380 3/12 (25%)
leucine-rich repeat 171..201 CDD:275380 3/29 (10%)
LRR_RI 210..464 CDD:238064 69/255 (27%)
leucine-rich repeat 212..236 CDD:275380 3/23 (13%)
LRR_8 235..295 CDD:290566 20/59 (34%)
leucine-rich repeat 237..260 CDD:275380 5/22 (23%)
leucine-rich repeat 261..284 CDD:275380 9/22 (41%)
LRR_8 283..345 CDD:290566 15/61 (25%)
leucine-rich repeat 285..308 CDD:275380 5/22 (23%)
leucine-rich repeat 309..334 CDD:275380 5/24 (21%)
LRR_8 334..393 CDD:290566 16/58 (28%)
leucine-rich repeat 335..358 CDD:275380 4/22 (18%)
leucine-rich repeat 359..382 CDD:275380 7/22 (32%)
LRR_8 382..441 CDD:290566 22/59 (37%)
leucine-rich repeat 383..406 CDD:275380 11/22 (50%)
leucine-rich repeat 407..430 CDD:275380 6/23 (26%)
LRR_8 431..488 CDD:290566 20/57 (35%)
leucine-rich repeat 431..451 CDD:275380 8/20 (40%)
leucine-rich repeat 454..477 CDD:275380 5/22 (23%)
LRR_8 477..559 CDD:290566 34/88 (39%)
leucine-rich repeat 478..499 CDD:275380 9/21 (43%)
leucine-rich repeat 502..525 CDD:275380 9/27 (33%)
leucine-rich repeat 526..548 CDD:275380 7/22 (32%)
leucine-rich repeat 590..617 CDD:275380 5/26 (19%)
leucine-rich repeat 618..641 CDD:275380 0/22 (0%)
leucine-rich repeat 642..689 CDD:275380 15/51 (29%)
LRRCT 679..736 CDD:214507 15/57 (26%)
leucine-rich repeat 775..796 CDD:275380 3/41 (7%)
LRR_8 797..852 CDD:290566 8/61 (13%)
leucine-rich repeat 797..817 CDD:275380 4/26 (15%)
leucine-rich repeat 818..841 CDD:275380 1/22 (5%)
LRR_8 841..900 CDD:290566 11/53 (21%)
leucine-rich repeat 842..865 CDD:275380 6/31 (19%)
LRR_4 866..907 CDD:289563 5/19 (26%)
leucine-rich repeat 866..889 CDD:275380 5/19 (26%)
leucine-rich repeat 890..911 CDD:275380
TIR 1045..1183 CDD:214587
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380 5/18 (28%)
LRR_8 83..142 CDD:290566 26/108 (24%)
leucine-rich repeat 84..107 CDD:275380 9/22 (41%)
leucine-rich repeat 108..131 CDD:275380 10/48 (21%)
LRR_RI 129..421 CDD:238064 106/402 (26%)
LRR_8 132..190 CDD:290566 26/81 (32%)
leucine-rich repeat 132..155 CDD:275380 11/46 (24%)
leucine-rich repeat 156..179 CDD:275380 11/22 (50%)
leucine-rich repeat 180..204 CDD:275380 6/23 (26%)
LRR_8 203..263 CDD:290566 20/59 (34%)
leucine-rich repeat 205..228 CDD:275380 10/22 (45%)
leucine-rich repeat 229..252 CDD:275380 5/22 (23%)
LRR_8 252..308 CDD:290566 21/56 (38%)
leucine-rich repeat 253..276 CDD:275380 10/23 (43%)
leucine-rich repeat 277..300 CDD:275380 8/22 (36%)
leucine-rich repeat 301..322 CDD:275380 9/24 (38%)
LRR_8 325..384 CDD:290566 22/137 (16%)
leucine-rich repeat 326..350 CDD:275380 11/91 (12%)
leucine-rich repeat 351..373 CDD:275380 8/32 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453536
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.