DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 18w and CG18480

DIOPT Version :9

Sequence 1:NP_476814.1 Gene:18w / 37277 FlyBaseID:FBgn0004364 Length:1385 Species:Drosophila melanogaster
Sequence 2:NP_001285960.1 Gene:CG18480 / 34920 FlyBaseID:FBgn0028518 Length:550 Species:Drosophila melanogaster


Alignment Length:308 Identity:80/308 - (25%)
Similarity:127/308 - (41%) Gaps:65/308 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 LCAGSALSNANGAVSGGSELQTLDVSFNELRSLPDAWGASRLRRLQTLSLQHNNISTLAPNALAG 257
            :|:...|.:||..:....||  ||:|:|::.::.|....:.: .|..|:|.||.|.||..:|...
  Fly    59 VCSAKRLISANIEIPTTVEL--LDLSYNDITTIDDDSFKTTI-HLLNLTLAHNAIHTLYGDAFVE 120

  Fly   258 LSSLRVLNISYNHLVSLPSEAFAGNKELRELHLQGNDLYELPKGLLHRLEQLLVLDLSGNQLTSH 322
            |:.||.|::|||.|..:.......|.:|..|:|:||.|..|.||.:.|...|.            
  Fly   121 LTRLRYLDLSYNRLEQIDEHILESNNQLIHLNLEGNKLSTLGKGPILRSPSLR------------ 173

  Fly   323 HVDNSTFAGLIRLIVLNLSNNALTRIGSKTFKELYFLQILDMRNNSIGHIEEGAFLPLYNLHTLN 387
                          .|||.|:.:.::|::....|..|:.||:..|.:..:..|.|....||.:||
  Fly   174 --------------SLNLRNSQVNQLGTQLLSALPQLRQLDLAQNLLLTLSPGDFHAPRNLASLN 224

  Fly   388 LAENRLHTLDNRIFNGLYVLTKLT--LNNNLVSIVESQAFRNCSDLKELDLSSN----------- 439
            :.||.        ||....|.|:.  |....|:|..|    ||.:.:..|...:           
  Fly   225 VEENP--------FNCDRALAKVATGLRQRGVAIFMS----NCMEEEVQDHQDDAEAVNFPNKNE 277

  Fly   440 ---------QLTEVPEAVQDLSMLKTLDLGENQISEFKNNTFRNLNQL 478
                     ..|..|::|  ||:.:.||..|.|.|...:....:|:.:
  Fly   278 KFESMEYLEPSTRGPQSV--LSVWRDLDSSEEQNSSQDDEQMSSLSDV 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
18wNP_476814.1 leucine-rich repeat 66..91 CDD:275380
leucine-rich repeat 92..115 CDD:275380
LRR_8 115..181 CDD:290566
leucine-rich repeat 116..146 CDD:275380
leucine-rich repeat 147..170 CDD:275380
leucine-rich repeat 171..201 CDD:275380 2/7 (29%)
LRR_RI 210..464 CDD:238064 73/275 (27%)
leucine-rich repeat 212..236 CDD:275380 6/23 (26%)
LRR_8 235..295 CDD:290566 23/59 (39%)
leucine-rich repeat 237..260 CDD:275380 10/22 (45%)
leucine-rich repeat 261..284 CDD:275380 8/22 (36%)
LRR_8 283..345 CDD:290566 15/61 (25%)
leucine-rich repeat 285..308 CDD:275380 10/22 (45%)
leucine-rich repeat 309..334 CDD:275380 1/24 (4%)
LRR_8 334..393 CDD:290566 18/58 (31%)
leucine-rich repeat 335..358 CDD:275380 6/22 (27%)
leucine-rich repeat 359..382 CDD:275380 6/22 (27%)
LRR_8 382..441 CDD:290566 17/80 (21%)
leucine-rich repeat 383..406 CDD:275380 7/22 (32%)
leucine-rich repeat 407..430 CDD:275380 8/24 (33%)
LRR_8 431..488 CDD:290566 12/68 (18%)
leucine-rich repeat 431..451 CDD:275380 4/39 (10%)
leucine-rich repeat 454..477 CDD:275380 6/22 (27%)
LRR_8 477..559 CDD:290566 0/2 (0%)
leucine-rich repeat 478..499 CDD:275380 0/1 (0%)
leucine-rich repeat 502..525 CDD:275380
leucine-rich repeat 526..548 CDD:275380
leucine-rich repeat 590..617 CDD:275380
leucine-rich repeat 618..641 CDD:275380
leucine-rich repeat 642..689 CDD:275380
LRRCT 679..736 CDD:214507
leucine-rich repeat 775..796 CDD:275380
LRR_8 797..852 CDD:290566
leucine-rich repeat 797..817 CDD:275380
leucine-rich repeat 818..841 CDD:275380
LRR_8 841..900 CDD:290566
leucine-rich repeat 842..865 CDD:275380
LRR_4 866..907 CDD:289563
leucine-rich repeat 866..889 CDD:275380
leucine-rich repeat 890..911 CDD:275380
TIR 1045..1183 CDD:214587
CG18480NP_001285960.1 LRR_8 74..134 CDD:290566 23/62 (37%)
LRR_RI <76..230 CDD:238064 54/190 (28%)
leucine-rich repeat 76..99 CDD:275380 7/25 (28%)
leucine-rich repeat 100..123 CDD:275380 10/22 (45%)
LRR_8 122..182 CDD:290566 23/85 (27%)
leucine-rich repeat 124..147 CDD:275380 8/22 (36%)
leucine-rich repeat 148..171 CDD:275380 10/22 (45%)
LRR_8 170..230 CDD:290566 19/93 (20%)
leucine-rich repeat 172..195 CDD:275380 7/48 (15%)
leucine-rich repeat 196..219 CDD:275380 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468851
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.