DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 18w and LRFN5

DIOPT Version :10

Sequence 1:NP_476814.1 Gene:18w / 37277 FlyBaseID:FBgn0287775 Length:1385 Species:Drosophila melanogaster
Sequence 2:NP_689660.2 Gene:LRFN5 / 145581 HGNCID:20360 Length:719 Species:Homo sapiens


Alignment Length:168 Identity:62/168 - (36%)
Similarity:90/168 - (53%) Gaps:9/168 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 RLIVLNLSNNALTRIGSKTFKELYFLQILDMRNNSIGHIEEGAFLPLYNLHTLNLAENRLHTLDN 398
            |.:.|.|::|.:|.|..|.|..:..|..|.:..|:|..|...||..|.||..|:|..|||..:.|
Human    52 RTVELRLADNFVTNIKRKDFANMTSLVDLTLSRNTISFITPHAFADLRNLRALHLNSNRLTKITN 116

  Fly   399 RIFNGLYVLTKLTLNNNLVSIVESQAFRNCSDLKELDLSSNQLTEVP-EAVQDLSMLKTLDLGEN 462
            .:|:||..|..|.||||.::::.|.||.:...|:|||||.|.|..:| :||:.:..|.||.|..|
Human   117 DMFSGLSNLHHLILNNNQLTLISSTAFDDVFALEELDLSYNNLETIPWDAVEKMVSLHTLSLDHN 181

  Fly   463 QISEFKNNTFRNLNQLTGLRLIDNRIGNITVGMFQDLP 500
            .|......||.:|:::|.|.:..|::        |.||
Human   182 MIDNIPKGTFSHLHKMTRLDVTSNKL--------QKLP 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
18wNP_476814.1 leucine-rich repeat 66..91 CDD:275380
leucine-rich repeat 92..115 CDD:275380
LRR_8 115..181 CDD:404697
leucine-rich repeat 116..146 CDD:275380
leucine-rich repeat 147..170 CDD:275380
leucine-rich repeat 171..201 CDD:275380
LRR 210..592 CDD:443914 62/168 (37%)
leucine-rich repeat 212..236 CDD:275380
leucine-rich repeat 237..260 CDD:275380
leucine-rich repeat 261..284 CDD:275380
leucine-rich repeat 285..308 CDD:275380
leucine-rich repeat 309..334 CDD:275380 62/168 (37%)
leucine-rich repeat 335..358 CDD:275380 7/22 (32%)
leucine-rich repeat 359..382 CDD:275380 8/22 (36%)
leucine-rich repeat 383..406 CDD:275380 10/22 (45%)
leucine-rich repeat 407..430 CDD:275380 9/22 (41%)
leucine-rich repeat 431..451 CDD:275380 11/20 (55%)
leucine-rich repeat 454..477 CDD:275380 9/22 (41%)
leucine-rich repeat 478..499 CDD:275380 4/20 (20%)
leucine-rich repeat 502..525 CDD:275380
leucine-rich repeat 526..548 CDD:275380
leucine-rich repeat 590..617 CDD:275380
leucine-rich repeat 618..641 CDD:275380
leucine-rich repeat 642..689 CDD:275380
LRRCT 679..736 CDD:214507
LRR <775..>920 CDD:443914
leucine-rich repeat 775..796 CDD:275380
leucine-rich repeat 797..817 CDD:275380
leucine-rich repeat 818..841 CDD:275380
leucine-rich repeat 842..865 CDD:275380
leucine-rich repeat 866..889 CDD:275380
leucine-rich repeat 890..911 CDD:275380
TIR 1045..1183 CDD:214587
LRFN5NP_689660.2 LRR 1 52..73 8/20 (40%)
leucine-rich repeat 53..76 CDD:275380 7/22 (32%)
LRR <69..>211 CDD:443914 54/149 (36%)
LRR 2 76..97 7/20 (35%)
leucine-rich repeat 77..100 CDD:275380 8/22 (36%)
LRR 3 100..121 9/20 (45%)
leucine-rich repeat 101..124 CDD:275380 10/22 (45%)
LRR 4 124..145 9/20 (45%)
leucine-rich repeat 125..148 CDD:275380 9/22 (41%)
LRR 5 148..169 11/20 (55%)
leucine-rich repeat 149..172 CDD:275380 11/22 (50%)
LRR 6 172..193 8/20 (40%)
leucine-rich repeat 173..196 CDD:275380 9/22 (41%)
LRR 7 196..217 6/24 (25%)
leucine-rich repeat 197..215 CDD:275380 6/23 (26%)
LRRCT 240..>272 CDD:214507
IgI_SALM5_like 287..374 CDD:409421
Ig strand A 287..290 CDD:409421
Ig strand A' 294..297 CDD:409421
Ig strand B 303..311 CDD:409421
Ig strand C 317..322 CDD:409421
Ig strand C' 325..327 CDD:409421
Ig strand D 333..337 CDD:409421
Ig strand E 340..344 CDD:409421
Ig strand F 354..361 CDD:409421
Ig strand G 364..374 CDD:409421
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 385..414
FN3 421..494 CDD:473895
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 615..694
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.