DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 18w and LRRC15

DIOPT Version :9

Sequence 1:NP_476814.1 Gene:18w / 37277 FlyBaseID:FBgn0004364 Length:1385 Species:Drosophila melanogaster
Sequence 2:NP_001128529.2 Gene:LRRC15 / 131578 HGNCID:20818 Length:587 Species:Homo sapiens


Alignment Length:513 Identity:138/513 - (26%)
Similarity:219/513 - (42%) Gaps:115/513 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LLLLVADAHAQQQCN-WQYGLT----TMDIRCSVRALESGTG-------TPL-----DLQVAEAA 64
            |||||.       |. |..||.    ..:..||..:....||       |||     .||:... 
Human    13 LLLLVG-------CQAWGAGLAYHGCPSECTCSRASQVECTGARIVAVPTPLPWNAMSLQILNT- 69

  Fly    65 GRLDLQCSQELLHASELAPGLFRQLQKLSELRIDACKLQRVPPNAFEGLMSLKRLTLESHNAVWG 129
                        |.:||....|..:..|..|||:..:|.|:.|.||..|.||:.|:         
Human    70 ------------HITELNESPFLNISALIALRIEKNELSRITPGAFRNLGSLRYLS--------- 113

  Fly   130 PGKTLELHGQSFQGLKELSELHLGDNNIRQLPEGVWCSMPSLQLLNLTQNRIRSAEFLGFSEKLC 194
                                  |.:|.::.||.|::..:.||:.|.|:.|::...:...||:  |
Human   114 ----------------------LANNKLQVLPIGLFQGLDSLESLLLSSNQLLQIQPAHFSQ--C 154

  Fly   195 AGSALSNANGAVSGGSELQTLDVSFNELRSLPDAWGA-SRLRRLQTLSLQHNNISTLAPNALAGL 258
                           |.|:.|.:..|.|..:||  || ..|..|..|:|..|:::.::|.....|
Human   155 ---------------SNLKELQLHGNHLEYIPD--GAFDHLVGLTKLNLGKNSLTHISPRVFQHL 202

  Fly   259 SSLRVLNISYNHLVSLPSEAFAGNKELRELHLQGNDLYELPKGLLHRLEQLLVLDLSGNQLTSHH 323
            .:|:||.:..|.|..:|...|.|...|:||.||.|.:..|..||.|               .:|:
Human   203 GNLQVLRLYENRLTDIPMGTFDGLVNLQELALQQNQIGLLSPGLFH---------------NNHN 252

  Fly   324 VDNSTFAGLIRLIVLNLSNNALTRIGSKTFKELYFLQILDMRNNSIGHIEEGAFLPLYNLHTLNL 388
            :..           |.||||.::::....|.:|..|..|.:..||:..:..|.|.|:.||..|.|
Human   253 LQR-----------LYLSNNHISQLPPSVFMQLPQLNRLTLFGNSLKELSPGIFGPMPNLRELWL 306

  Fly   389 AENRLHTLDNRIFNGLYVLTKLTLNNNLVSIVESQAFRNCSDLKELDLSSNQLTEVPEAV-QDLS 452
            .:|.:.:|.:.:|:.|..|..|.|:.|.:|.:...||...::|:||.|.:|.|.::...| :.|:
Human   307 YDNHISSLPDNVFSNLRQLQVLILSRNQISFISPGAFNGLTELRELSLHTNALQDLDGNVFRMLA 371

  Fly   453 MLKTLDLGENQISEFKNNTFRNLNQLTGLRLIDNRIGNITVGMFQDLPRLSVLNLAKN 510
            .|:.:.|..|::.:...|.|.|:|.|..::|.:|::.|:.:|:|..|.:|..|.|..|
Human   372 NLQNISLQNNRLRQLPGNIFANVNGLMAIQLQNNQLENLPLGIFDHLGKLCELRLYDN 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
18wNP_476814.1 leucine-rich repeat 66..91 CDD:275380 4/24 (17%)
leucine-rich repeat 92..115 CDD:275380 10/22 (45%)
LRR_8 115..181 CDD:290566 13/65 (20%)
leucine-rich repeat 116..146 CDD:275380 2/29 (7%)
leucine-rich repeat 147..170 CDD:275380 5/22 (23%)
leucine-rich repeat 171..201 CDD:275380 7/29 (24%)
LRR_RI 210..464 CDD:238064 75/255 (29%)
leucine-rich repeat 212..236 CDD:275380 9/24 (38%)
LRR_8 235..295 CDD:290566 20/59 (34%)
leucine-rich repeat 237..260 CDD:275380 6/22 (27%)
leucine-rich repeat 261..284 CDD:275380 8/22 (36%)
LRR_8 283..345 CDD:290566 16/61 (26%)
leucine-rich repeat 285..308 CDD:275380 10/22 (45%)
leucine-rich repeat 309..334 CDD:275380 1/24 (4%)
LRR_8 334..393 CDD:290566 19/58 (33%)
leucine-rich repeat 335..358 CDD:275380 7/22 (32%)
leucine-rich repeat 359..382 CDD:275380 7/22 (32%)
LRR_8 382..441 CDD:290566 20/58 (34%)
leucine-rich repeat 383..406 CDD:275380 7/22 (32%)
leucine-rich repeat 407..430 CDD:275380 7/22 (32%)
LRR_8 431..488 CDD:290566 18/57 (32%)
leucine-rich repeat 431..451 CDD:275380 7/20 (35%)
leucine-rich repeat 454..477 CDD:275380 6/22 (27%)
LRR_8 477..559 CDD:290566 11/34 (32%)
leucine-rich repeat 478..499 CDD:275380 6/20 (30%)
leucine-rich repeat 502..525 CDD:275380 4/9 (44%)
leucine-rich repeat 526..548 CDD:275380
leucine-rich repeat 590..617 CDD:275380
leucine-rich repeat 618..641 CDD:275380
leucine-rich repeat 642..689 CDD:275380
LRRCT 679..736 CDD:214507
leucine-rich repeat 775..796 CDD:275380
LRR_8 797..852 CDD:290566
leucine-rich repeat 797..817 CDD:275380
leucine-rich repeat 818..841 CDD:275380
LRR_8 841..900 CDD:290566
leucine-rich repeat 842..865 CDD:275380
LRR_4 866..907 CDD:289563
leucine-rich repeat 866..889 CDD:275380
leucine-rich repeat 890..911 CDD:275380
TIR 1045..1183 CDD:214587
LRRC15NP_001128529.2 LRR_8 60..119 CDD:290566 21/102 (21%)
LRR_RI 63..309 CDD:238064 85/334 (25%)
LRR_8 88..167 CDD:290566 29/126 (23%)
leucine-rich repeat 88..108 CDD:275380 9/19 (47%)
leucine-rich repeat 109..156 CDD:275380 15/94 (16%)
leucine-rich repeat 157..180 CDD:275380 9/24 (38%)
LRR_8 180..239 CDD:290566 20/58 (34%)
leucine-rich repeat 181..204 CDD:275380 6/22 (27%)
leucine-rich repeat 205..228 CDD:275380 8/22 (36%)
LRR_8 228..287 CDD:290566 21/84 (25%)
leucine-rich repeat 229..252 CDD:275380 10/37 (27%)
leucine-rich repeat 253..276 CDD:275380 7/33 (21%)
leucine-rich repeat 277..300 CDD:275380 7/22 (32%)
LRR_8 299..359 CDD:290566 20/59 (34%)
LRR_4 299..340 CDD:289563 13/40 (33%)
leucine-rich repeat 301..324 CDD:275380 7/22 (32%)
LRR_4 324..364 CDD:289563 13/39 (33%)
leucine-rich repeat 325..348 CDD:275380 7/22 (32%)
leucine-rich repeat 349..370 CDD:275380 7/20 (35%)
LRR_8 372..430 CDD:290566 18/58 (31%)
leucine-rich repeat 373..393 CDD:275380 5/19 (26%)
leucine-rich repeat 397..418 CDD:275380 6/20 (30%)
TPKR_C2 429..>468 CDD:301599 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8435
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.