DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16898 and pkdc

DIOPT Version :9

Sequence 1:NP_611452.2 Gene:CG16898 / 37276 FlyBaseID:FBgn0034480 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_001335286.1 Gene:pkdc / 797003 ZFINID:ZDB-GENE-041111-115 Length:322 Species:Danio rerio


Alignment Length:205 Identity:45/205 - (21%)
Similarity:78/205 - (38%) Gaps:53/205 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 EYRTIILEDL------AQYNYVNADRVKQLDLAHTKLTLEVLAKFHAASIVVKQRHPE-LLTKSL 180
            |.:.|:||||      .:..|||.        |..|..|..:|.|||..:.|.   || |.....
Zfish   106 EEQLIVLEDLDVAGFPVRKTYVND--------AEIKACLSWIANFHALFLDVT---PEGLWPIGT 159

  Fly   181 FIHCFSRDNKGYTEVYEGVLSAFIRFINEQPVLKKKYGNKLQKIHENIMDYGARTFEVGEQELLT 245
            :.|..:|..:             :..:::|.:  |....::..|..|.             ...|
Zfish   160 YWHLETRPEE-------------LEAMSDQKL--KAAAGEIDSILNNC-------------RFKT 196

  Fly   246 LSHGDCWTTNFLYQYDDASNPQSAVAIDFQFSNFTSPVNDLHQFFTVSLRDEVQDMESV--LVEK 308
            :.|||....||.:..|..    ...::|||:......:.|: .:|..|..||.:..:..  |::.
Zfish   197 IVHGDAKLANFCFSKDGL----QVASVDFQYVGGGCGMKDV-IYFLGSCMDERECEKKAPGLLDY 256

  Fly   309 YYSDLKTNVD 318
            |:|:|:.:::
Zfish   257 YFSELRKSLE 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16898NP_611452.2 EcKinase 37..322 CDD:281023 45/205 (22%)
pkdcXP_001335286.1 PKc_like <96..267 CDD:304357 45/205 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589352
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.