DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16898 and CG10562

DIOPT Version :9

Sequence 1:NP_611452.2 Gene:CG16898 / 37276 FlyBaseID:FBgn0034480 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_651385.3 Gene:CG10562 / 43066 FlyBaseID:FBgn0039326 Length:405 Species:Drosophila melanogaster


Alignment Length:429 Identity:105/429 - (24%)
Similarity:193/429 - (44%) Gaps:53/429 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LPNWLTEEYLQPKLRAYYKDDQLKVVKVWAKPATEKGQNYMSLMTRIHVEIQQGDGLLQNRTYII 66
            :|:|:|.|..:..|:|.. |...|:....|...:..|:||.::|.|:.:|::..||..::.:|::
  Fly     6 IPDWVTAEIFEDLLKANV-DGYSKIKNFKADIGSAAGENYATIMLRVKIEVELQDGKSKSVSYMV 69

  Fly    67 K-----ESLSEDCPQAKVFLEYDVYNREMDMYEFILPKMNELLQEVGLTGKFTA---DTIFVDRE 123
            |     |::.|...:..:|      ..|..||..::|::..|.:.||:...|.|   |......:
  Fly    70 KLPHQVEAIQEMMKRTNIF------EIERTMYNEVVPELEALYKAVGVDITFGAKNYDLKNAKTD 128

  Fly   124 YRTIILEDLAQYNYVNADRVKQLDLAHTKLTLEVLAKFHAAS---IVVKQRHPELLTKSLFIHCF 185
            |  :.||||....:.||:|::.||..||:..|..|:::||||   :..|..:|::|.:..|    
  Fly   129 Y--VALEDLGLKGFKNANRLEGLDQEHTERVLRKLSQWHAASAVRVATKGPYPKILLQGFF---- 187

  Fly   186 SRDNKGYTEVYEGVLSAFIR-----FINEQPVLK--KKYGNKLQKIHENIMDYGARTFE---VGE 240
                   .|....|:|..|:     |:......:  :.|.:|::.:....:|   :.||   |..
  Fly   188 -------KEESRPVMSEMIKGMGANFVKSCATYEGHEAYLDKVKALQPVAID---KIFEFAKVEP 242

  Fly   241 QELLTLSHGDCWTTNFLYQYDDASNPQSAVAIDFQFSNFTSPVNDLHQFF--TVSLRDEVQDMES 303
            .|...|:|||.|:.|.::|||.....:....:|:|...:.:...||..|.  :..|.|::...: 
  Fly   243 TEFNVLNHGDSWSNNIMFQYDAFGKIKEVYLVDYQLPKYGTVAQDLLYFLLSSTKLEDKLAKFD- 306

  Fly   304 VLVEKYYSDLKTNVDTLSYKGIFPSLQGFQ-KQFESRRFMCLLAHLFKPVIIYDGTEVSSDFSSV 367
            ..::.|:.:|..::..|.|....|||:... ..|:...|...:|......::.|.|:     |:.
  Fly   307 YYIKIYHDNLVEHLKILKYSKPIPSLRDIHLALFKYGYFGYTVATGVMSAVLLDPTD-----SAS 366

  Fly   368 YKDTEEGIRFQKAIYANERVLKSATKLLAMLDAKGVLNL 406
            .::...|..||..:|.:.|..|....::..|..:|.|.|
  Fly   367 LENFIGGSDFQMQLYNSPRYRKHIQAVMPWLLNRGALEL 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16898NP_611452.2 EcKinase 37..322 CDD:281023 76/307 (25%)
CG10562NP_651385.3 EcKinase 41..325 CDD:281023 76/306 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459400
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
87.860

Return to query results.
Submit another query.