DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16898 and CG10550

DIOPT Version :9

Sequence 1:NP_611452.2 Gene:CG16898 / 37276 FlyBaseID:FBgn0034480 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_651380.2 Gene:CG10550 / 43061 FlyBaseID:FBgn0039321 Length:425 Species:Drosophila melanogaster


Alignment Length:424 Identity:115/424 - (27%)
Similarity:185/424 - (43%) Gaps:41/424 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LPNWLTEEYLQPKLRAYYKDDQL--KVVKVWAKPATEKGQNYMSLMTRIHVEIQQGDGLLQNRTY 64
            :|.|:.|||.||.:.   ||.:.  |::.:....||..|:||.|:|.|:.|:|...||..|..:|
  Fly    19 IPKWINEEYFQPIIE---KDVENFDKIINLVPIAATAPGENYTSIMIRVIVDILLKDGSEQRVSY 80

  Fly    65 IIKESLSEDCPQAKVFLEYDVYNREMDMYEFILPKMNELLQEVGLTGKFTADTIFVDR--EYRTI 127
            |:|..|..| ..|.|.....::.:|..|||..:|:..:|.:|.||..:.....:.||.  |..|:
  Fly    81 ILKTMLEAD-SGADVIDGMGLFPKERKMYEVHIPQFVKLYKEAGLEIELAPKCLHVDATDELITM 144

  Fly   128 ILEDLAQYNYVNADRVKQLDLAHTKLTLEVLAKFHAASIVVKQ---RHPELLTKSLFIHCFSRDN 189
            :.|||::.|:.|.||:|..||.|.:..|..||:.||||:|.|:   .:..:...|::       |
  Fly   145 VFEDLSRQNFKNFDRLKGFDLPHMREVLRKLAELHAASVVAKEINGPYDAMYNMSIY-------N 202

  Fly   190 KGYTEVYEGVLSAFIRFINEQPVLKKKYGNKLQKIHENIMDYGARTF-------------EVGEQ 241
            :...:::|.:...     .|:..||......|    ||...|.||.:             :|.|.
  Fly   203 EQSRDLFESLGKQ-----REEQFLKAMRNWDL----ENAESYIARMWDPLEVFEEAVQVNQVDED 258

  Fly   242 ELLTLSHGDCWTTNFLYQYDDASNPQSAVAIDFQFSNFTSPVNDLHQFFTVSLRDEVQDME-SVL 305
            |...|:|||||:.|.::.|.|.......:.:|.|...:.||..||....|.|...:::..| ...
  Fly   259 EFNVLNHGDCWSNNIMFNYKDNGEIDRTILVDLQVGKWGSPAQDLWYLITTSASLDIKIKEFDHF 323

  Fly   306 VEKYYSDLKTNVDTLSYKGIFPSLQGFQKQFESRRFMCLLAHLFKPVIIYDGTEVSSDFSSVYKD 370
            ::.|:..|...:..|:|....|:|:..........|...|..:...|.....|:..::...:...
  Fly   324 IQIYHQRLAECLKLLNYSKPIPTLRDLHIMMLKYGFWGPLTAMGVMVATLMPTDKDANMKMILAQ 388

  Fly   371 TEEGIRFQKAIYANERVLKSATKLLAMLDAKGVL 404
            ..|....:...:.|....|:...||...|.||:|
  Fly   389 GPEADAIRYRTFINPYYAKAMKVLLPFFDNKGLL 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16898NP_611452.2 EcKinase 37..322 CDD:281023 87/303 (29%)
CG10550NP_651380.2 EcKinase 53..340 CDD:281023 87/303 (29%)
APH 108..338 CDD:279908 66/245 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459394
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.