DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16898 and CG13658

DIOPT Version :9

Sequence 1:NP_611452.2 Gene:CG16898 / 37276 FlyBaseID:FBgn0034480 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster


Alignment Length:408 Identity:103/408 - (25%)
Similarity:179/408 - (43%) Gaps:45/408 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PNWLTEEYLQPKLRAYYKDDQLKVVKVWAKPATEKGQNYMSLMTRI--HVEIQQGDGLLQNRTYI 65
            |.||..|.::..||||.||.:|.|..:...|||.:|.:|.|:|.|.  |....:|:   .::..|
  Fly    18 PAWLNAELIEGALRAYEKDPELHVTDLKISPATLQGDHYASVMFRAVSHYSTAKGN---FSKALI 79

  Fly    66 IKESLSEDCPQAKVFLEYDVYNREMDMYEFILPKMNELLQEVGLTGKFTADTIFVDRE-YRTIIL 129
            :|....::..:..:.....::..|:.||...||::..:|:|.|.|.|..|..|:...| ::.:|.
  Fly    80 VKTMPEQEGHKKDMLSNSPIFKTEILMYSKALPELERILREAGDTTKLYAPCIYHSLEPHQVMIF 144

  Fly   130 EDLAQYNY-VNADRV---KQLDLAHTKLTLEVLAKFHAASIVVKQRHPELLTKSLF----IHCFS 186
            |||....| |..||.   ::|..|..|     |||:||||:.|....|:.|.:..:    :..|.
  Fly   145 EDLVPQGYTVIRDRYPNKEELQKAFFK-----LAKWHAASMKVLNERPDFLKEFKYGLWGMPNFL 204

  Fly   187 RDNKGYTEVYEGVLSAFIRFINEQPVLKKKYGNKLQKIHENIMDYGARTFEVGEQELLT------ 245
            .|:...|.|     ..|:..:::.|.| .||....:||.:|.:...:...|    |..|      
  Fly   205 NDSIVTTGV-----PCFLEMLDKVPEL-TKYKPYFEKIKDNYIQQMSAVME----EYRTNPKPNR 259

  Fly   246 ---LSHGDCWTTNFLYQYD-DASNPQSAVAIDFQFSNFTSPVNDL-HQFFTVSLRDEVQDMESVL 305
               |.|||....|.:::|: :..:.:..:.:|||.||......|| :..|.|...::..|:....
  Fly   260 YYVLCHGDFHGRNMMFRYNKETGSFEDVMLVDFQISNVCPLSIDLIYSIFMVMDTEDRWDLGKEY 324

  Fly   306 VEKYYSDLKTNVDTLSYKGIFPSLQGFQKQFESRR-FMCLLAHLFKPVIIYDGTEVSSDFSSVYK 369
            :..|:|.|...:..:.:||..|:..|..:.....: :...:...|.|::....|:......|.:.
  Fly   325 INYYFSVLADTLKKIGFKGEMPTQTGVWEHIHGHKDYEFFMMTSFLPLVAAMNTKTFKSMDSFFD 389

  Fly   370 DTEEGIRFQKAIYANERV 387
            ...:    ||:.:.:|.:
  Fly   390 PQTK----QKSFFLDEYI 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16898NP_611452.2 EcKinase 37..322 CDD:281023 77/306 (25%)
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 77/306 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459547
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.