DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16898 and CG14314

DIOPT Version :9

Sequence 1:NP_611452.2 Gene:CG16898 / 37276 FlyBaseID:FBgn0034480 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_650690.1 Gene:CG14314 / 42179 FlyBaseID:FBgn0038581 Length:438 Species:Drosophila melanogaster


Alignment Length:401 Identity:94/401 - (23%)
Similarity:161/401 - (40%) Gaps:57/401 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LTEEYLQPKLRAYYKDDQLKVVKVWAKPATEKGQNYMSLMTRIHVEIQQGDGLLQNRTYIIKESL 70
            |:.|..|...:....|.|:...::  ...:::|.||.:.:.||.:..::..  |:....:|.:.:
  Fly    26 LSLEVFQDIFKHVEPDVQIDAFEL--AQGSDRGDNYTAALYRIKLTGKRRS--LKWEQNVICKVM 86

  Fly    71 SEDCPQAKVFLEYDVYNREMDMYEFILPKMNELLQ-EVGLTGK----FTADTIFVDREYRTIILE 130
            .|.....:.:....::..|:..|..|:|   |||: :...|.:    |.|........:..:|:|
  Fly    87 PESVVAREAYKSDKLFRNEVQFYNTIMP---ELLKFQASKTNQDTPVFNAIPKCYSARHDLLIME 148

  Fly   131 DLAQYNYVNADRVKQLDLAHTKLTLEVLAKFHAASIVVKQRHP-------ELLTKSLFIHCFSRD 188
            ||.:..:..:||.|.|.|..|:..|..:|:.|..|:..|...|       .::::.:|  | :.:
  Fly   149 DLRERGFQMSDRHKGLSLEETQSVLLQVAQLHGLSLAYKFEKPLEFSNLCSMISEGIF--C-TAN 210

  Fly   189 NKGYTEVYEGVLSAFIRFINEQPVLKKKYGNKLQKIHENIMDYGARTFEVG--EQELLTLSHGDC 251
            ...|...||.:....|:.::|......||...:.|..|:...:| |..::.  |..|..:.||||
  Fly   211 TSWYRNYYERLTKNAIQMVSEVLPPDSKYVLAMNKFAESSSFFG-RMVKLASTESPLSAICHGDC 274

  Fly   252 WTTNFLYQYD--DASNPQSAVAIDFQFSNFTSPVNDLHQFFTVSLRDEVQDMESVLVEKYYSD-- 312
            |..||||.||  |.........:|||...::|...|:..........|::|.:...:.|.|::  
  Fly   275 WVNNFLYHYDPEDPHRVLEVALLDFQLIRYSSIALDIANLLYCCTTKEMRDAQLQTLLKIYTEEL 339

  Fly   313 ------LKTNV----DTLSYKGIFPSLQGFQKQFESR-----RFMCLLAHLFKPVIIYDGTEVSS 362
                  |.||:    ||         ||..|..|...     ||...||....|:    .|..|.
  Fly   340 FRWLQMLCTNLPDHCDT---------LQKLQDLFAEELKTYGRFALGLALDILPI----STCSSE 391

  Fly   363 DFSSVYKDTEE 373
            |...:|.|..:
  Fly   392 DAPDMYLDRSD 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16898NP_611452.2 EcKinase 37..322 CDD:281023 75/312 (24%)
CG14314NP_650690.1 EcKinase 56..346 CDD:281023 70/298 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
43.910

Return to query results.
Submit another query.