DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16898 and CG13813

DIOPT Version :9

Sequence 1:NP_611452.2 Gene:CG16898 / 37276 FlyBaseID:FBgn0034480 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_649195.1 Gene:CG13813 / 40218 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster


Alignment Length:382 Identity:91/382 - (23%)
Similarity:159/382 - (41%) Gaps:66/382 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 AKPATEKGQNYMSLMTRIHVEIQQGDGLLQNRTYIIKESLSEDCPQAKVFLEYDVYNREMDMYEF 95
            ::|....|:|....:.|:     ....::...|.::|.:...:..::.:.: .|.|.||:.||:.
  Fly    27 SQPMAGVGENAYGQVLRV-----SWPTIVDAATVVVKMAPRNEARRSHMHV-VDYYAREVFMYQK 85

  Fly    96 ILPKMNELLQEVGLTGKFT------ADTIFVDREYRTIILEDLAQYNYVNADRVKQLDLAHTKLT 154
            :.|....|..:   ...||      |:.:....|:  :|.|||::..:....|...........:
  Fly    86 VFPVFRALSPD---RNTFTVAPALQANDLKAPDEF--LIFEDLSESGFRPNSRCIMPTYDIVVCS 145

  Fly   155 LEVLAKFHAASIVVKQRHPELLTKSLFIHCFSRDNKGYTEVYEGVLSAF--IRFINEQPVLKKKY 217
            |:.||:.||.|.:::|..| |..|.| :....:||. :|...|.|...|  .:....:.:||:..
  Fly   146 LKALAELHACSFILQQTDP-LQFKQL-VEFVEKDNL-FTSDIEEVTIEFGKAQLRKARIILKESD 207

  Fly   218 GNKLQKIHENIMDYGARTFEVGEQELLTLS----------------HGDCWTTNFLYQYD-DASN 265
            |:::..:.|        ..::.|.:|.:|:                |||.|..|.||::: ::..
  Fly   208 GDQVAAVQE--------VLQLCENQLKSLALYCVDGKAQAPHAVICHGDFWNNNILYRHEPNSDQ 264

  Fly   266 PQSAVAIDFQFSNFTSPVNDL-HQFFTVS---LRDE-VQDMESVLVEKYYS--DLKTNVDTLSYK 323
            |..|..||||.|.:..||.|: |..|..:   |||| ..|    .::.||:  |.|.....||.:
  Fly   265 PVEAKLIDFQMSRYAPPVLDIVHYLFACTEKRLRDEHFPD----FMDAYYNTMDQKLKSCNLSLE 325

  Fly   324 GIFPSLQGFQKQFESRRFMCLLAHLFK-PVIIYDGTE------VSSDFSSVYKDTEE 373
            ||:|. ..|.:|.:......|:...|. |..|.:..|      ||....|:...::|
  Fly   326 GIYPR-SVFNRQLQQYGVYGLIMGAFSLPFFISNANEVIDIDTVSEAIQSISTSSDE 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16898NP_611452.2 EcKinase 37..322 CDD:281023 75/316 (24%)
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 74/312 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459592
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S12414
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.890

Return to query results.
Submit another query.